PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462916534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 316aa    MW: 33598.1 Da    PI: 8.3571
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462916534genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.25e-431085176
               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
        SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
               +CqvegC +dls ak y+ rhkvC++hskap v+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrr++
  462916534 10 RCQVEGCGVDLSGAKPYYCRHKVCSMHSKAPLVVVAGIEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRRP 85
               6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-34472IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.163885IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.89E-41989IPR004333Transcription factor, SBP-box
PfamPF031101.4E-331184IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
GAGATANPAR CQVEGCGVDL SGAKPYYCRH KVCSMHSKAP LVVVAGIEQR FCQQCSRFHQ  60
LPEFDQGKRS CRRRLAGHNE RRRRPPPGPL TTRYGRLAAS FQEPGRFRSF LLDFSYPRVS  120
STASDAWPAV RPGNRMSSTI QWQGSHELHP HRSAVAGYGD HAYVGPGGSG AMPPAFDLPP  180
GGCVAGVATD SSCALSLLST QPWDTTQSAS HHQSPAMSTA SAFEGTPVSP SVMASSYTAA  240
STWTGSRVHE GARNLQHHAP HEDDLHLVHP GSAHHGHFSG ELELALQGSG PSNPPQGDHG  300
SGGTYGHSSN AVNWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3011841184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462916534
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0417771e-102BT041777.2 Zea mays full-length cDNA clone ZM_BFb0053F21 mRNA, complete cds.
GenBankHQ8586791e-102HQ858679.1 Zea mays clone UT1135 SBP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802689.11e-174squamosa promoter-binding-like protein 17
SwissprotA3C0571e-153SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0A9EA231e-178A0A0A9EA23_ARUDO; Uncharacterized protein
STRINGPavir.Ba01711.1.p1e-178(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-37squamosa promoter binding protein-like 9