PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462916234
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 514aa    MW: 54877.6 Da    PI: 6.6432
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462916234genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.79.1e-3461051100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+C+++C++a yfp e+  +fa+vhk+FGasnv+kll+++ + +r  a++slvyeA ar+rdP  G+++ i+ l++ l+q  a++a+++ e
  462916234   6 PCAGCKHLRRRCVASCAFASYFPPEHGDQFAAVHKVFGASNVSKLLAEVAPGDRAGAVESLVYEATARLRDPAFGCASYITVLEHVLKQGMADVAAARGE 105
                7*******************************************************************************************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.6965106IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-336102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MPSPPPCAGC KHLRRRCVAS CAFASYFPPE HGDQFAAVHK VFGASNVSKL LAEVAPGDRA  60
GAVESLVYEA TARLRDPAFG CASYITVLEH VLKQGMADVA AARGELAAHV GAAAAFRPFD  120
AASASPEARR AGEEKLDAAL RFAKEQDEKM RAVRAALDAK RKQGSVVAWK DGGKRGHGQP  180
LLNRQMAEAQ SAREQAVIAQ QHGHRAVTGQ GVPEGHPHQQ IAEASESAAA APGAREQAMM  240
ARQAAAAQQQ RHHVVAQNGT GLAFPDGRVR GNPRHQTVQQ IADAQPAEAE MLATSAAASW  300
EKQEMKMRAV RGDELYYHPA MGREHPNPSQ LHMANAKQLA AAEDVAWEQE LMLRQAAAAV  360
TGDQNMSTMM QQDAAAAADF TRDPNVMMML QQAVGGKQQQ HQVEQYAAMV QQIANGQQQL  420
SAAAELVARE KQDLMTVQQQ QQAAAYAQHA MPGSISGAMV AFLVQHQPLL QPLLAELPRE  480
QENDGGDDDG QLSDLAAYFG IPGPSLPPDG RGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-30610611111LOB family transfactor Ramosa2.1
5ly0_B7e-30610611111LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMap462916234
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16457913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-33ASYMMETRIC LEAVES 2-like 1