PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462915264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 117aa    MW: 13284.5 Da    PI: 10.1641
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462915264genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               +ri+n +nrqvtfskRr g++KKA EL +LCda+v +i+fs tg+lye+ss
  462915264  9 ERIDNRTNRQVTFSKRRSGLMKKARELGILCDADVGLIVFSCTGRLYEFSS 59
               69***********************************************96 PP

2K-box52.32.5e-18591103485
      K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                + RhllGe+L+ L+ ++Lq L++q+e sl++iR+kK++ll e+i +l +k +
  462915264  59 STRHLLGEELSGLTARDLQFLQSQVEMSLQSIRKKKEQLLAEEIMQLNQKVQ 110
                57***********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.062161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-27261IPR002100Transcription factor, MADS-box
CDDcd002659.27E-36260No hitNo description
PRINTSPR004044.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-261057IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.2814117IPR002487Transcription factor, K-box
PRINTSPR004044.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-1459110IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGRGKIAIER IDNRTNRQVT FSKRRSGLMK KARELGILCD ADVGLIVFSC TGRLYEFSST  60
RHLLGEELSG LTARDLQFLQ SQVEMSLQSI RKKKEQLLAE EIMQLNQKVQ VTCPAIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-19160160MEF2C
5f28_B5e-19160160MEF2C
5f28_C5e-19160160MEF2C
5f28_D5e-19160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462915264
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967658.18e-55MADS-box transcription factor 25 isoform X1
RefseqXP_022682316.18e-55MADS-box transcription factor 25 isoform X1
SwissprotQ84NC51e-49MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLA0A368R0W52e-53A0A368R0W5_SETIT; Uncharacterized protein
STRINGPavir.J07457.1.p8e-56(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.23e-40AGAMOUS-like 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]