PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462914919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 250aa    MW: 27463.2 Da    PI: 9.9863
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462914919genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42411401100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r da+ss+vyeA ar+rdPvyG++g i +lq ql+ lka+la++++e
  462914919  41 PCAACKILRRRCADGCVLAPYFPPTEPHKFATAHRVFGASNIIKLLQDLPEEQRADAVSSMVYEAAARIRDPVYGCAGAICQLQLQLNDLKAQLARAHAE 140
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.33240141IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4241138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDSSCDTTLC TLLTVNKLSP GSSPPPPPTS PQLAPAVVLS PCAACKILRR RCADGCVLAP  60
YFPPTEPHKF ATAHRVFGAS NIIKLLQDLP EEQRADAVSS MVYEAAARIR DPVYGCAGAI  120
CQLQLQLNDL KAQLARAHAE LAGARAQHAH LLALVCCMEV AAGAPLLRRP RRRRRALRRR  180
RRKLAAAGQP RQLGRPAALD MSTNISITLI HICADIYKYI QLINMCTEYG DWVYRVSCVR  240
KWNNSKLTKG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167172RRPRRR
2167174RRPRRRRR
3170183RRRRRALRRRRRKL
4176183LRRRRRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539372e-77EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960340.11e-80PREDICTED: LOB domain-containing protein 1
TrEMBLK3ZCZ91e-80K3ZCZ9_SETIT; Uncharacterized protein
STRINGSi024430m4e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-53LOB domain-containing protein 11