PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462914689
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family CPP
Protein Properties Length: 772aa    MW: 83868 Da    PI: 6.6473
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462914689genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16458496240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  462914689 458 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 496
                689**********************************96 PP

2TCR50.25e-16543582140
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  462914689 543 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 582
                589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-17457498IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.38458583IPR005172CRC domain
PfamPF036388.7E-12460495IPR005172CRC domain
SMARTSM011143.5E-16543584IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11545581IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MDTPNRPLAP PTSRAEDSPL FGFIDNLSPI EPVKSAYTAS SLQGYQTINI TSISSIFTSP  60
HDNAQKEPRL LKSPLAQISE IEECAEGSDR SKTSTKSANA VRLFASTGTV TQETQTVTCS  120
VVVDQCDGPC DLSQPTVQFD TGSPDHNTTP CHGVRSDLKQ DKCRKIEAVH TIKNTLEKRK  180
CLFSTEIQLL DGSQPEKDSD EVMGCQWSDL ISTTSGELLA YDTSIDEHHR GVQLAVNNAE  240
SCGYLLSKLT GDGDPAASGS AYYQELMMGE DQIEKTQIFQ DGQPIISTEE IQDNIYDANG  300
GVPLGYKVET QQQRGIRRRC LVFEASGFSN SLVQKETVED MSASCKGKSH VETKISKSKL  360
QSRVPRGIGL HLNALTTTPK GKMACQDPMA SALVPVSTSE HDMHGKLLSA GENFTHSGGE  420
LLELSMDDSE GFPDRVSSQS GSPQKKRRKA DNGDDGESCK RCSCKKSKCL KLYCECFAAG  480
VYCSEPCSCQ GCLNKPIHEE IVLSTRKQIE FRNPLAFAPK VIRMSETGQE TGEDPNNTPA  540
SARHKRGCNC KKSSCLKKYC ECYQGGVGCS SNCRCESCKN TFGRRDADIE LTEEMKQEGE  600
ETKICVEKEN DQQKANVQNE DHPLLELVPI TPPFDVSSSL LLKPPNFSSA KPPRPTKARS  660
SNSRSSASKV TETVQSRKIS KVANSGRSEE MPDVLREDNS PSSCVKTTSP NGKRVSPPHN  720
ALSISPNRKG GRKLILKSIP SFPSLMGEAN NSSAMNSVDS KLSAPPLALG PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1546058012120Protein lin-54 homolog
5fd3_B1e-1546058012120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444448KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462914689
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799594.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A2S3GWC50.0A0A2S3GWC5_9POAL; Uncharacterized protein
STRINGSb02g004250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-82TESMIN/TSO1-like CXC 2