PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462914201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bZIP
Protein Properties Length: 250aa    MW: 26967.8 Da    PI: 5.8223
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462914201genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42e-15131186459
                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                 k+ rr+ +NRe+ArrsR+RK+  +  Le  v  L+aeN +L k+l+ ++++++  
  462914201 131 AKKKRRMLSNRESARRSRKRKQTHLNDLESQVSRLTAENASLLKRLDDMTQKYKDA 186
                699****************************************9999998888755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-18125192IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.588130182IPR004827Basic-leucine zipper domain
PfamPF001702.2E-13131184IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-12132183No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-13132184No hitNo description
CDDcd147024.21E-18133183No hitNo description
PROSITE patternPS000360135150IPR004827Basic-leucine zipper domain
PfamPF124982.4E-11200250IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAGGTGDEVV EVSCGGGGGD PGAYAAVLKR KLDLYCAAVA KSMEARSQES SFGHPNSQAS  60
DTSQLISQAS DTSQLISQAS FDGDGDRGSI FINSHVIDNT NCQGKQANSD TSKEQSDDDG  120
DLEESTDPIN AKKKRRMLSN RESARRSRKR KQTHLNDLES QVSRLTAENA SLLKRLDDMT  180
QKYKDATLDN RNLTVDVEMM RRKVDIAEEA VRRVTGASML LLPTKSDMPG RSRSMTSCAS  240
DAASAAVPIQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131135KKKRR
2133150KRRMLSNRESARRSRKRK
3144150RRSRKRK
4144151RRSRKRKQ
5146151SRKRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap462914201
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805357.11e-112light-inducible protein CPRF2-like
TrEMBLA0A2S3HFB11e-111A0A2S3HFB1_9POAL; Uncharacterized protein
TrEMBLA0A2T7EIZ51e-111A0A2T7EIZ5_9POAL; Uncharacterized protein
STRINGSi022331m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75952943
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.28e-27bZIP family protein