PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462913299
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 474aa    MW: 51666 Da    PI: 9.1884
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462913299genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.4e-4151127278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C vegC+adls++++yhrrhkvCe+hsk+pvv+v+g++qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  462913299  51 CSVEGCAADLSKCRDYHRRHKVCEAHSKTPVVTVAGQQQRFCQQCSRFHLLCEFDEVKRSCRKRLDGHNRRRRKPQP 127
                **************************************************************************987 PP

2SBP46.21.2e-142242594378
                -TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP  43 CqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   C  fh l efDe krsCr+rL++hn+rrrk+q+
  462913299 224 LCPCREFHLLCEFDEVKRSCRKRLDGHNRRRRKPQP 259
                5569*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.7E-3343112IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12948125IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.03E-3849130IPR004333Transcription factor, SBP-box
PfamPF031103.3E-2951124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114113.084180257IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-12223262IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.108.3E-4226244IPR004333Transcription factor, SBP-box
PfamPF031105.1E-7227256IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MPRCLLGTSA RWSAPAAAAP WTSSSAGRSP SSSAPAKRPR AGQAQQAVPA CSVEGCAADL  60
SKCRDYHRRH KVCEAHSKTP VVTVAGQQQR FCQQCSRFHL LCEFDEVKRS CRKRLDGHNR  120
RRRKPQPDPM NPGALFANHH GMTRFTSYPQ LFSAPSMADS KWPATTIVKA ETDAFQDHYY  180
PAVHLNNGAV SLFNGKDRKH FPFLTPHGGI TRTTDSVLFS DAFLCPCREF HLLCEFDEVK  240
RSCRKRLDGH NRRRRKPQPD PMNPGALFAN HHGMTRFTSY PQLFSAPSMA DSKWPATIVK  300
AETDAFQDHY YPAVHLNNGA VSLFNGKDRK HFPFLTPHGG DAAAALGCQP FTITPSSESN  360
SKQSNGNCAL SLLSDNSTPA QLMIPTGQPL GAALHYGNVA RLPDDGDVSL TGMSYVSMGD  420
KQTSIVATSA GHTATAASPA PATQLQYHGY YHVNGGDQGN SDGASIQALP FSSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-2648124884squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239256KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462913299
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971091.11e-117squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-78SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLK3XIT11e-116K3XIT1_SETIT; Uncharacterized protein
STRINGSi001804m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-31SBP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]