PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462913130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 26746.2 Da    PI: 7.6032
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462913130genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF991.9e-311059251
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklye++s
  462913130 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEFAS 59
               8***********************************************86 PP

2K-box90.62.8e-30851691195
      K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                 +++e++ +e+ +Lk++++ Lq++qR+llGe+L+sL+ keLqqLeqqL++slk+iRs+Kn+l++++i+elqkk  e+++e+++  
  462913130  85 IEDQENWGEEYMRLKSKLDALQKSQRQLLGEQLDSLTTKELQQLEQQLDSSLKHIRSRKNQLMFDSISELQKKLMEAEKEKNNAL 169
                56789********************************************************************999998877654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.45161IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-33291IPR002100Transcription factor, MADS-box
CDDcd002653.24E-43274No hitNo description
PRINTSPR004043.1E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-2686167IPR002487Transcription factor, K-box
PROSITE profilePS5129715.98688179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEFASN  60
GSMEGILERY QRYSFEEKAV LDPSIEDQEN WGEEYMRLKS KLDALQKSQR QLLGEQLDSL  120
TTKELQQLEQ QLDSSLKHIR SRKNQLMFDS ISELQKKLME AEKEKNNALL NVMEQQNGAS  180
TSSPSPPPAS VPDSMPTLNI GPHQPNGAGE ESEPEPSPAQ ANRGKLPPWM LSNVSNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A8e-22174173MEF2 CHIMERA
6byy_B8e-22174173MEF2 CHIMERA
6byy_C8e-22174173MEF2 CHIMERA
6byy_D8e-22174173MEF2 CHIMERA
6bz1_A1e-21174173MEF2 CHIMERA
6bz1_B1e-21174173MEF2 CHIMERA
6bz1_C1e-21174173MEF2 CHIMERA
6bz1_D1e-21174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462913130
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306951e-161AJ430695.1 Zea mays mRNA for putative MADS-domain transcription factor (m28 gene).
GenBankBT0333971e-161BT033397.1 Zea mays full-length cDNA clone ZM_BFb0049C14 mRNA, complete cds.
GenBankEU9629061e-161EU962906.1 Zea mays clone 246416 MADS-box transcription factor 18 mRNA, complete cds.
GenBankKJ7275721e-161KJ727572.1 Zea mays clone pUT5432 MADS transcription factor (MADS67) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958248.11e-137MADS-box transcription factor 18
SwissprotA2YNI21e-126MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T41e-126MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLA0A1L5YFA11e-140A0A1L5YFA1_PANVG; APL3
STRINGPavir.Ba00457.1.p1e-141(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.13e-62MIKC_MADS family protein
Publications ? help Back to Top
  1. Jia H, et al.
    Characterization and transcriptional profiles of two rice MADS-box genes.
    Plant Sci., 2000. 155(2): p. 115-122
    [PMID:10814814]
  2. Chen C, et al.
    Adapting rice anther culture to gene transformation and RNA interference.
    Sci. China, C, Life Sci., 2006. 49(5): p. 414-28
    [PMID:17172048]
  3. Yoshida H, et al.
    superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
    Plant Biotechnol. J., 2007. 5(6): p. 835-46
    [PMID:17764519]
  4. Yao SG,Ohmori S,Kimizu M,Yoshida H
    Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
    Plant Cell Physiol., 2008. 49(5): p. 853-7
    [PMID:18378529]
  5. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  6. Kobayashi K, et al.
    Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene.
    Plant Cell, 2012. 24(5): p. 1848-59
    [PMID:22570445]
  7. Wei X, et al.
    Fine mapping of BH1, a gene controlling lemma and palea development in rice.
    Plant Cell Rep., 2013. 32(9): p. 1455-63
    [PMID:23689259]
  8. Wang H, et al.
    OsMADS32 interacts with PI-like proteins and regulates rice flower development.
    J Integr Plant Biol, 2015. 57(5): p. 504-13
    [PMID:25081486]
  9. Lombardo F, et al.
    The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice.
    Plant Biotechnol. J., 2017. 15(1): p. 97-106
    [PMID:27336225]