PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462913019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 592aa    MW: 66859.6 Da    PI: 6.298
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462913019genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS234.64.4e-722305843373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL+  A+av++++++++ +lL++++++a+ +g+p+qRla++f+++L+arl++++++l + l +++ s   + e l a++l++ ++ + +++      +I
  462913019 230 TLLIYWAQAVAANNHKNTWELLKQIKQHAAATGNPTQRLAQCFAKGLEARLVGTGTKLWELLMVERPS---VMEFLEAYQLYVAACSFDNIALSFSVMTI 326
                68999*******************************************************99999998...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp.fefnvlvakrledleleeLrvkp 198
                ++ + g++++Hi+D+                +R++ pp+++iT++g+ +++     +++eetg+rL ++A elg+p f+f++ + +++ed+ +++L++++
  462913019 327 MDKMVGKRKLHIVDY----------------EREGVPPQVKITAIGHLHPSsyaADDQIEETGHRLYRLALELGLPsFKFHA-IRTKWEDICIKDLNTDS 409
                **************9................599*************888888999*******************66*****.799************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +E+l+Vn  ++l +l+desv+ ++  +rd+vL  +++++P+v+v +  ++ + ++sFl rf  al +y+alfd+l+a++pres+ r+++E+ l+gr ++n
  462913019 410 NEVLVVNDLFNLSTLMDESVCFDDpnPRDTVLGNIRKMRPDVFVQSIVNCTY-GTSFLSRFKGALFHYMALFDMLDATIPRESKPRMVLEQGLFGRYAMN 508
                ********************9998889*************************.679******************************************** PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ++aceg + ++  e++ +W++r ++aG++ +pl+ ++++  +   +k+++d + + e+ +++++gW++r L++ SaW
  462913019 509 AIACEGLDLVHYPEKYTQWQARNQRAGLRLMPLKPDIVMGLENKAKKHHKD-FLLSEDGHWVLQGWMGRILFAHSAW 584
                *************************************************77.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.281202566IPR005202Transcription factor GRAS
PfamPF035141.5E-69230584IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MQQSPPSPSL FPDQPPLPHG GDGQLSPNDM MLPYISRMLM EDDVEDKVCD HPALLQVQEP  60
FAQILFAPSF GVNWGNNTNT ANRDGTKDLL QDGSCDQSTI DSAFLKGADA VGSFLKGMEE  120
AKTFLPKNDN FKRNELVNQR FGENSNHCGP KEMYSRDAHL EEARIAEKSV TVMEPEGVDA  180
RKMLDEVMVH GYEKCISDMK KLRITIANEV KKNSRKSGVN PVKHVVDLPT LLIYWAQAVA  240
ANNHKNTWEL LKQIKQHAAA TGNPTQRLAQ CFAKGLEARL VGTGTKLWEL LMVERPSVME  300
FLEAYQLYVA ACSFDNIALS FSVMTIMDKM VGKRKLHIVD YEREGVPPQV KITAIGHLHP  360
SSYAADDQIE ETGHRLYRLA LELGLPSFKF HAIRTKWEDI CIKDLNTDSN EVLVVNDLFN  420
LSTLMDESVC FDDPNPRDTV LGNIRKMRPD VFVQSIVNCT YGTSFLSRFK GALFHYMALF  480
DMLDATIPRE SKPRMVLEQG LFGRYAMNAI ACEGLDLVHY PEKYTQWQAR NQRAGLRLMP  540
LKPDIVMGLE NKAKKHHKDF LLSEDGHWVL QGWMGRILFA HSAWVVEDTP SE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1325158426374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677891.10.0PREDICTED: scarecrow-like protein 34 isoform X1
RefseqXP_008677892.10.0PREDICTED: scarecrow-like protein 34 isoform X2
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-96GRAS family protein