PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462912961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bHLH
Protein Properties Length: 397aa    MW: 43891.2 Da    PI: 6.1981
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462912961genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.1e-09217246130
                CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
        HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                +r++h ++Er+RR+++N+ +  Lr+l+P +
  462912961 217 QRMTHIAVERNRRRQMNEYLRILRSLMPGS 246
                79**************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000839.08E-7215256No hitNo description
Gene3DG3DSA:4.10.280.101.7E-7215247IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.455216270IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.78E-8216247IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.3E-6217246IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGRQDALSAD TKTPCHPDAR TRGSTPYFDV AGPGKARRVR VGVAHLRPSC GEQGSHHGHL  60
DSFAPLDGAP EEQQPTGGSG AEMVDYMLGQ AASQPTTGQS QQVSSFDKLS FSDVLQFADF  120
GPKLALNQRA AAAASSDRDD DDDDDGYFFR FHSLPPSLQQ QQQHVEQEGS KTTADGQGIS  180
ESTTLVQQAE KEQQQQGKSG RRKRPRTVKT SEEVESQRMT HIAVERNRRR QMNEYLRILR  240
SLMPGSYVQR ILDLDVGGGV REEVAENKSC LADIEVRALG ADAMIKILSR RRPGQLIRTI  300
AALEEMQMSI LHTNITTIEQ TVLYSEEVAE NKSCLADIEV RALGADAMIK ILSRRRPGQL  360
IRTIAALEEM QMSILHTNIT TIDQTVLYSF NVKLTEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217228RMTHIAVERNRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:17088607, PubMed:17183265, PubMed:17183267). Together with MYB88 and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Together with SPCH and MUTE, regulates the stomata formation. Required to promote differentiation and morphogenesis of stomatal guard cells and to halt proliferative divisions in their immediate precursors. Mediates the formation of stomata (PubMed:17088607, PubMed:17183265, PubMed:17183267). Prevents histone H3K27me3 marks and derepresses stem cell gene expression (PubMed:24654956). {ECO:0000269|PubMed:17088607, ECO:0000269|PubMed:17183265, ECO:0000269|PubMed:17183267, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956}.
Cis-element ? help Back to Top
SourceLink