PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462911871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 143aa    MW: 15793.8 Da    PI: 4.7847
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462911871genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.36.4e-2028902789
     DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89
                ++fa+vhk+FGasn +kll++++ ++r+da+ +++yeA+ r+++PvyG+++ il+lq+q ++
  462911871 28 IENFAVVHKVFGASNASKLLHQVSLDKRQDAVLTICYEAKERLSNPVYGCASYILALQEQKDS 90
               589*******************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.0051104IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-192389IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MVGRTMVAIQ EEEEEEEVVA GRVGREGIEN FAVVHKVFGA SNASKLLHQV SLDKRQDAVL  60
TICYEAKERL SNPVYGCASY ILALQEQKDS AFLYFTLGHS RQSLDPVPLL NGDPTSEDAG  120
TSHRQLWVCV NVQVDIGHPL NLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-1418872796LOB family transfactor Ramosa2.1
5ly0_B2e-1418872796LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMap462911871
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2Z5CVL96e-23A0A2Z5CVL9_9TRAC; LBDA
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03760.12e-23LOB domain-containing protein 20