PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462911077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 354aa    MW: 37233.7 Da    PI: 10.8083
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462911077genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.96.1e-4363138176
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                +CqvegC +dls ak y+ rhkvC++hskap v+v+g+eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrr++
  462911077  63 RCQVEGCGVDLSGAKPYYCRHKVCSMHSKAPLVVVAGIEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRRP 138
                6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-3457125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.16361138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.1E-4062142IPR004333Transcription factor, SBP-box
PfamPF031101.7E-3364137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MPVALAGLPR SRRPNSHAHS HRHTVTRAQG PGSAEAHGRH GGGGAASSAS SGSGAGATAN  60
PARCQVEGCG VDLSGAKPYY CRHKVCSMHS KAPLVVVAGI EQRFCQQCSR FHQLPEFDQG  120
KRSCRRRLAG HNERRRRPPP GPLTTRYGRL AASFQEPGRF RSFLLDFSYP RVSSTASDAW  180
PAMQPGTRMS STIPWQGSHE LHPHRSAAVA GYGDHAYIGP GGSGAPMAPA FELPPGGCVA  240
GVATDSSCAL SLLSTQPWDT TQSASHHRST AMSTASAFEG TPVSPSVMAS SYAAASTWTG  300
SRVHEGARNL QLPLPPTTAT SPASSSLRCR EAGRPTRRKA IMSLGEPTGT PAMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30641371184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462911077
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0417771e-114BT041777.2 Zea mays full-length cDNA clone ZM_BFb0053F21 mRNA, complete cds.
GenBankHQ8586791e-114HQ858679.1 Zea mays clone UT1135 SBP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802689.11e-138squamosa promoter-binding-like protein 17
SwissprotA3C0571e-128SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0A9EA231e-145A0A0A9EA23_ARUDO; Uncharacterized protein
STRINGPavir.Ba01711.1.p1e-142(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25273787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-36squamosa promoter binding protein-like 9