PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462909386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 130aa    MW: 15223.2 Da    PI: 11.2889
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462909386genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP51.52.6e-163364578
               TTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP 45 qCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               +C rfh+lsefDe+krsCr+rL++hn+rrrk+q+
  462909386  3 RCLRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQN 36
               7******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114115.742134IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.3E-6321IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.51E-14339IPR004333Transcription factor, SBP-box
PfamPF031102.3E-9333IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MRRCLRFHML SEFDEGKRSC RKRLDGHNRR RRKPQNDFMN LGSFFPYSQV NQFAIYPQST  60
SRSGQNSDSM HVVDRQRSPS HSREPSWHQS SSLYLRTVVA CSMHPVHLIF WRSITPTPEP  120
AAYATLSPAR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11633KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462909386
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.14e-35putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317606.14e-35putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317607.14e-35putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317608.13e-35putative squamosa promoter-binding-like protein 19 isoform X2
SwissprotQ2R3Y16e-25SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLC5Y2L58e-34C5Y2L5_SORBI; Uncharacterized protein
STRINGSb05g017510.11e-34(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-15SBP family protein