PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462909350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 112aa    MW: 11771.1 Da    PI: 8.6328
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462909350genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP72.86.2e-2366112248
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                C v+gC++dls+++eyhrrhkvCe+hsk+pvv+v g+eqrfCqqCsr
  462909350  66 CAVDGCRSDLSRCREYHRRHKVCEAHSKTPVVVVGGQEQRFCQQCSR 112
                **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-2361112IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.03363112IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-2265112IPR004333Transcription factor, SBP-box
PfamPF031109.7E-1766112IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MDWGVASGAS SWGAAADRGP TMLSFAGPSS SSTTSIAAEI QLQDFSGPAG AGRRSRAAGR  60
GVPEACAVDG CRSDLSRCRE YHRRHKVCEA HSKTPVVVVG GQEQRFCQQC SR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-1666112652squamosa promoter-binding protein-like 12
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462909350
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336082e-51AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355692e-51AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149672e-51AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.13e-44putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317606.13e-44putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317607.13e-44putative squamosa promoter-binding-like protein 19 isoform X1
TrEMBLC5Y2L58e-43C5Y2L5_SORBI; Uncharacterized protein
STRINGSb05g017510.11e-43(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-22SBP family protein