PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462908898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 229aa    MW: 25244.6 Da    PI: 4.9132
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462908898genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.93.4e-1928882787
     DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87
                ++fa+vhk+FGasn +kll++++ ++r+da+ +++yeA+ r+++PvyG+++ il+lq+q 
  462908898 28 IENFAVVHKVFGASNASKLLHQVSLDKRQDAVLTICYEAKERLSNPVYGCASYILALQEQR 88
               589*******************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.6361102IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-182488IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MVGRTMVAIQ EEEEEEEVVA GRVGREGIEN FAVVHKVFGA SNASKLLHQV SLDKRQDAVL  60
TICYEAKERL SNPVYGCASY ILALQEQRRG TFSLLSCHLE TTCATHSLLT MGDKNKPFSC  120
HLQEYLEVSE KKEGSSSAPP QPPSDPPAEP ILDVVPVEAP LVDIAPLAMI PPPLEQEPLA  180
LPEFIEISSD DEDASSARPR RRYLPGGRAD LRPKYFGVFS GTRSRSRQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-1329873896LOB family transfactor Ramosa2.1
5ly0_B3e-1329873896LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMap462908898
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03760.12e-22LOB domain-containing protein 20