PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462908312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 225aa    MW: 24152.5 Da    PI: 8.7666
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462908312genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26050.46.6e-161756140
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40
               +CaaCk +rrkCa+dC+lapyfpa++p+++a+v+++FG +
  462908312 17 RCAACKNQRRKCAQDCILAPYFPASDPQRYACVKRIFGSR 56
               6*************************************86 PP

2DUF260118.24.8e-37621621101
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk +rrkCa+dC+lapyfpa++p+++a+v+++FGasn+ +++++lp ++r +a+++++ eA+ r++dPvyG++gvi +lq +++ +++ela+++++
  462908312  62 RCAACKNQRRKCAQDCILAPYFPASDPQRYACVKRIFGASNIARMIQSLPVHDRGKAADTMATEAHRRVQDPVYGCAGVIARLQDEIRAVQSELARTEAQ 161
                6**********************************************************************************************99987 PP

     DUF260 101 l 101
                +
  462908312 162 I 162
                5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.3E-131756IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089123.75461162IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3662159IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSTSANTGAV AANPGRRCAA CKNQRRKCAQ DCILAPYFPA SDPQRYACVK RIFGSRSRQP  60
GRCAACKNQR RKCAQDCILA PYFPASDPQR YACVKRIFGA SNIARMIQSL PVHDRGKAAD  120
TMATEAHRRV QDPVYGCAGV IARLQDEIRA VQSELARTEA QIAVHAAAAA GAQPAAGNQL  180
NAQLVQGPMQ QQGDALMVQE PFPALDALLN DVHAGANLFD DDMGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-316317612125LOB family transfactor Ramosa2.1
5ly0_B2e-316317612125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462908312
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025806770.11e-66LOB domain-containing protein 24-like
SwissprotP594683e-38LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2S3HD563e-65A0A2S3HD56_9POAL; Uncharacterized protein
TrEMBLA0A3L6TJP82e-65A0A3L6TJP8_PANMI; Uncharacterized protein
STRINGPavir.J09684.1.p7e-62(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-37LOB domain-containing protein 24