PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462906066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 172aa    MW: 19537.1 Da    PI: 9.5116
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462906066genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.6e-26959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+ien + rqvtfskRr+g++KKA+EL vLCda+v v+ fsstg+ly++ss
  462906066  9 KKIENMTSRQVTFSKRRTGLFKKAKELAVLCDAQVGVLAFSSTGRLYDFSS 59
               68***********************************************96 PP

2K-box55.13.4e-19611253498
      K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                + R+llG++L+ ++++++++Le+qLe sl +iR kK+ ll++q eel++k ++++een +Lrkk 
  462906066  61 STRRLLGQNLSGMDFEDIKSLENQLEISLHNIRIKKETLLIQQNEELRHKFDAIHEENINLRKKG 125
                67************************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.721161IPR002100Transcription factor, MADS-box
CDDcd002659.19E-34366No hitNo description
PRINTSPR004043.7E-25323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-27386IPR002100Transcription factor, MADS-box
PfamPF003197.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.76241134IPR002487Transcription factor, K-box
PfamPF014868.0E-1759124IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MVRGKTVMKK IENMTSRQVT FSKRRTGLFK KAKELAVLCD AQVGVLAFSS TGRLYDFSSS  60
STRRLLGQNL SGMDFEDIKS LENQLEISLH NIRIKKETLL IQQNEELRHK FDAIHEENIN  120
LRKKGERSAQ KSSATEYSIT SPVEEDDDHH VHLELSQPQH PGKGKPETST LS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462906066
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641670.12e-52MADS-box transcription factor 23-like
SwissprotA2RVQ52e-43AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A0E0LBE37e-54A0A0E0LBE3_ORYPU; Uncharacterized protein
STRINGOPUNC06G13170.11e-54(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.24e-46AGAMOUS-like 16
Publications ? help Back to Top
  1. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]