PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462903331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 514aa    MW: 57833.2 Da    PI: 9.199
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462903331genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.81.8e-1131345051373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a++l+  +  + k++++  N 
  462903331 134 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAYQLYMAAICFKKVAFIFSNY 230
                6789************************************************************999998...899************************ PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I++a+ g++++Hi+D++i++G+QWp++l+ +a+R++gpp++RiTg++ p++g   +e++eetg+rL+++A+e+gvpf++++++a+++e+++ e+L+++p
  462903331 231 TIYNAALGKKKIHIVDYGIQYGFQWPCFLRRIANREGGPPEVRITGIDIPQPGfrPTERIEETGRRLSNYAREFGVPFKYHAIAASKMESVRKEDLNIDP 330
                ****************************************************9*********************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+
  462903331 331 DEVLIVNCLYQFKNLMDESVVIESPRDVVLNNIRKMRPHTFIHAIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRAALNVI 430
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg++r+er et+++W+ r ++aG+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W
  462903331 431 ACEGTDRVERPETYKQWQVRNQRAGLKQLPLNSEIMQVVRSKVKDCYHKDFVIDVDHNWLLQGWKGRILYAISTW 505
                ***********************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.3108486IPR005202Transcription factor GRAS
PfamPF035146.4E-111134505IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MRALMAQLRE NGPDKLGVRS AGVPAPSPPA VPAVARSVKQ EAVDAVPGVG RGRKNPYADE  60
ELEIEGGRSS KQSALQGEDD ATRDMLDRVM MPSHESCVLQ MQQLRIAMQE EAAKNEAANG  120
KAKGRRGSRE VVDLRTLLIH CAQAVATDDR RSATELLKQI KQHASPQGDG TQRLAHCFAE  180
GLQARLAGTG SMVYQSLMAK RTSAVALLQA YQLYMAAICF KKVAFIFSNY TIYNAALGKK  240
KIHIVDYGIQ YGFQWPCFLR RIANREGGPP EVRITGIDIP QPGFRPTERI EETGRRLSNY  300
AREFGVPFKY HAIAASKMES VRKEDLNIDP DEVLIVNCLY QFKNLMDESV VIESPRDVVL  360
NNIRKMRPHT FIHAIVNGSF SAPFFVTRFR EALFYYSALF DVLDTTTPRD SDQRMLIEQN  420
IFGRAALNVI ACEGTDRVER PETYKQWQVR NQRAGLKQLP LNSEIMQVVR SKVKDCYHKD  480
FVIDVDHNWL LQGWKGRILY AISTWVANDA GSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-461385058374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-172SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0FDC60.0A0A0E0FDC6_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-162GRAS family protein