PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462901257
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 776aa    MW: 85811.4 Da    PI: 4.793
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462901257genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.93.3e-1063957671373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++ L++cA+av++gdl+ a+++L+++++++sp+gd++qR+a++f+e+L+arla+++s +y++l +++ts   +++ l+a+klf  +s + k +h     
  462901257 395 LRTMLIHCAQAVATGDLRSAHEMLKQIKQHSSPRGDATQRMAHCFAEGLEARLAGTGSLVYQSLVSKRTS---VVDFLKAYKLFMAASAFKKAQHTFSTM 491
                5789*************************************************************99999...*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +Il+av+g +++Hi+ +++++G+QWp Ll+ La R++gpp++R Tg++ p++g   + +le+tgerL++ A++++vpf+f++ +a ++e+++ ++L+++p
  462901257 492 TILNAVAGRSKLHIVEYGVQHGFQWPGLLHFLAGREGGPPEVRFTGIDLPQPGfrPAYQLEKTGERLSNCARQFRVPFKFHA-IAAKWETVTAQDLNIDP 590
                ****************************************************9999**************************.799************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +E+l+Vn+     +l+desv ++s  +rd vL+ +++++P+v+v++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  +E+ l+gr++ n
  462901257 591 DEVLVVNCECFFDKLMDESVLVDSpsPRDVVLSNIRNMRPNVFVHCVVNGTFGAPFFLTRFREALFFYSAHFDMLDATIPRDNDVRLLIEQDLIGRSALN 690
                *******************98887779************************************************************************* PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                v+acega+r+ r et+++W+ r ++aG++++pls ++++ ++  +r+++ + + ++e++ +l++gWk+r L+++S W
  462901257 691 VIACEGADRVDRPETYKQWQVRNNRAGLRQLPLSPEVVNIVRGKVRNYYHKDFLLDEDHRWLLQGWKGRVLYAMSTW 767
                *************************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.042369748IPR005202Transcription factor GRAS
PfamPF035141.2E-103395767IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MAATPEEFLG QGAFLAVPEP FSPSVFLDLP PTPRPDGDDD PASSDDLVLP FISHMLMEED  60
IDDKFFYQYP DHPALLNAQQ PYAQILSDAT TSSSSDSAAT TLSPSCSSDA PASAEPTWPY  120
DPIELAQLLR SPPYTDMGVG LDDFGADDLS AVLLPAQDGA TPGFQQSPLT VNSDGSGGQA  180
QGASFAGEAV QSSVYLGGAK EEQDDAKANI TTLPTSDEAL ASAFFGGHKG VNMDMLNRAF  240
AQGMEEAKKF LPANNALFID LEATTTGERL LSTDSKPKGG LMLMTRQVKE EETVADEMPT  300
MFRESSNGRG RKNRHHGEDL EAETGRSSKQ MMQEEQEETG AQEMYTELMS CNYEDFVKRM  360
EDLRVAMDSE SEKSSRRGSG KGARGRQRAD DVVDLRTMLI HCAQAVATGD LRSAHEMLKQ  420
IKQHSSPRGD ATQRMAHCFA EGLEARLAGT GSLVYQSLVS KRTSVVDFLK AYKLFMAASA  480
FKKAQHTFST MTILNAVAGR SKLHIVEYGV QHGFQWPGLL HFLAGREGGP PEVRFTGIDL  540
PQPGFRPAYQ LEKTGERLSN CARQFRVPFK FHAIAAKWET VTAQDLNIDP DEVLVVNCEC  600
FFDKLMDESV LVDSPSPRDV VLSNIRNMRP NVFVHCVVNG TFGAPFFLTR FREALFFYSA  660
HFDMLDATIP RDNDVRLLIE QDLIGRSALN VIACEGADRV DRPETYKQWQ VRNNRAGLRQ  720
LPLSPEVVNI VRGKVRNYYH KDFLLDEDHR WLLQGWKGRV LYAMSTWVAD DNNSIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-363997678374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370646e-34AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149676e-34AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK1021996e-34AK102199.1 Oryza sativa Japonica Group cDNA clone:J033087D22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677823.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK3ZHD30.0K3ZHD3_SETIT; Uncharacterized protein
STRINGSi025985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-144SCARECROW-like 14