PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462900874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 24683.8 Da    PI: 10.7605
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462900874genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.94.8e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               +ri+n +nrqvtfskRr g++KKA EL +LCda+v +i+fs tg+lye+ss
  462900874  9 ERIDNRTNRQVTFSKRRSGLMKKARELGILCDADVGLIVFSCTGRLYEFSS 59
               69***********************************************96 PP

2K-box73.55.9e-25841711198
      K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 a+a+ +q+e++ L+++++nLq ++RhllGe+L+ L+ ++Lq L++q+e sl++iR+kK++ll e+i +l +k   lq+en +L+k++
  462900874  84 IAEAKFWQREVTTLRQQVQNLQLNNRHLLGEELSGLTARDLQFLQSQVEMSLQSIRKKKEQLLAEEIMQLNQKGLVLQKENIELKKEV 171
                57889********************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.202161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-32280IPR002100Transcription factor, MADS-box
CDDcd002652.54E-40271No hitNo description
PRINTSPR004041.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-2386171IPR002487Transcription factor, K-box
PROSITE profilePS5129713.84987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGRGKIAIER IDNRTNRQVT FSKRRSGLMK KARELGILCD ADVGLIVFSC TGRLYEFSST  60
SMKSIIERYQ EAREENNCRL LNRIAEAKFW QREVTTLRQQ VQNLQLNNRH LLGEELSGLT  120
ARDLQFLQSQ VEMSLQSIRK KKEQLLAEEI MQLNQKGLVL QKENIELKKE VSIAHRHKME  180
LQKKGKALRV IANKLAEALI KLTERNKKIG MHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-23187187MEF2C
5f28_B6e-23187187MEF2C
5f28_C6e-23187187MEF2C
5f28_D6e-23187187MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462900874
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967658.11e-106MADS-box transcription factor 25 isoform X1
RefseqXP_022682316.11e-106MADS-box transcription factor 25 isoform X1
SwissprotQ84NC51e-98MAD25_ORYSJ; MADS-box transcription factor 25
TrEMBLA0A368R0W51e-105A0A368R0W5_SETIT; Uncharacterized protein
STRINGPavir.J07457.1.p1e-114(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.13e-64AGAMOUS-like 44
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]