PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462900835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 295aa    MW: 33490.2 Da    PI: 9.3543
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462900835genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.32.3e-244178138
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i
  462900835 41 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALI 78
               79***********************************9 PP

2K-box102.36.5e-341082045100
      K-box   5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                s++  ++e +a+++qqe+akL++ i++Lq+++R l+G+ ++++sl++L+qLe +Le++++kiR++Knell+++++++qk+e el+++n +Lr+k++e
  462900835 108 SNTGtVAEVNAQYYQQESAKLRQTISSLQNSNRTLVGDAINTMSLRDLKQLEGRLERGINKIRARKNELLYAEVDYMQKREMELHSDNLYLRTKVAE 204
                33335999**************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-283395IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.313378IPR002100Transcription factor, MADS-box
CDDcd002653.20E-3434104No hitNo description
PRINTSPR004048.0E-233555IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-2335102IPR002100Transcription factor, MADS-box
PfamPF003191.3E-204278IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-235570IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-237091IPR002100Transcription factor, MADS-box
PfamPF014863.1E-25117202IPR002487Transcription factor, K-box
PROSITE profilePS5129714.361118208IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MLNMMADLSC GPSKVKEQPT PANSGPSAGS DKPARGKIEI KRIENTTNRQ VTFCKRRNGL  60
LKKAYELSVL CDAEVALIGS QLLNSVHTLY LFVKATIERY KKANTDTSNT GTVAEVNAQY  120
YQQESAKLRQ TISSLQNSNR TLVGDAINTM SLRDLKQLEG RLERGINKIR ARKNELLYAE  180
VDYMQKREME LHSDNLYLRT KVAENERGHE QPMGMQMEAA STSEYEHMVP YDSRNFLQVS  240
IMQQPQNYSH HLQPTTLQLG SNQKAPKYMC ARNFYHLSVL SQLLVLLGVR ELDNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A2e-143499163Myocyte-specific enhancer factor 2B
1n6j_B2e-143499163Myocyte-specific enhancer factor 2B
1tqe_P2e-143499264Myocyte-specific enhancer factor 2B
1tqe_Q2e-143499264Myocyte-specific enhancer factor 2B
1tqe_R2e-143499264Myocyte-specific enhancer factor 2B
1tqe_S2e-143499264Myocyte-specific enhancer factor 2B
6c9l_A2e-143499264Myocyte-specific enhancer factor 2B
6c9l_B2e-143499264Myocyte-specific enhancer factor 2B
6c9l_C2e-143499264Myocyte-specific enhancer factor 2B
6c9l_D2e-143499264Myocyte-specific enhancer factor 2B
6c9l_E2e-143499264Myocyte-specific enhancer factor 2B
6c9l_F2e-143499264Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462900835
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816639.11e-147MADS-box transcription factor 3 isoform X2
SwissprotQ407041e-124MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0A8XZ731e-156A0A0A8XZ73_ARUDO; Uncharacterized protein
STRINGPavir.Ea00226.1.p1e-142(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.16e-93MIKC_MADS family protein
Publications ? help Back to Top
  1. Kyozuka J,Shimamoto K
    Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants.
    Plant Cell Physiol., 2002. 43(1): p. 130-5
    [PMID:11828031]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]