PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462900735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 292aa    MW: 31009.4 Da    PI: 7.0886
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462900735genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS165.54.4e-5162292132374
       GRAS 132 LasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserde 226
                La+R+ +  sl++T+v +p+s       + +l ++gerL+k+Ae+ gv+ +f+v v+ r ++l+ ++L +++gE+laVnl+++l +++desvs +++rde
  462900735  62 LADRRVPGTSLKVTAVTDPTSPftqqpLTATLVAVGERLKKLAERAGVEYRFEV-VSCRAAELDASKLGCEHGEVLAVNLAFALSHVPDESVSPANPRDE 160
                99****************9988887777788999*******************9.7999***************************************** PP

       GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
                +L+ v+ l P+vv++veqe+++n++++ +rf++a+ +y a++dslea+l+r+s er++ E++ l++++ n+v  eg +r er+e ++             
  462900735 161 LLRRVRALGPQVVTLVEQELNTNTAPLYARFTDACAHYGAILDSLEATLGRDSAERAMAEAA-LAKKAANAVGREGPDRLERCEVFG------------- 246
                *************************************************************9.9********************665............. PP

       GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +ls ++a+q+ + +  ++  g+ ++ e+g l lgW++r ++++SaWr
  462900735 247 -TLSPSIADQVVARVGPTP-PGFAMKTENGVLRLGWNGRVVTVASAWR 292
                .69***************9.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.7121292IPR005202Transcription factor GRAS
PfamPF035141.5E-4862292IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MMVAALSSRI APAAAASAPA TQHLAELCGA EQRNGSQLLH ERSPCFRLAL HAANVAIVEA  60
YLADRRVPGT SLKVTAVTDP TSPFTQQPLT ATLVAVGERL KKLAERAGVE YRFEVVSCRA  120
AELDASKLGC EHGEVLAVNL AFALSHVPDE SVSPANPRDE LLRRVRALGP QVVTLVEQEL  180
NTNTAPLYAR FTDACAHYGA ILDSLEATLG RDSAERAMAE AALAKKAANA VGREGPDRLE  240
RCEVFGTLSP SIADQVVARV GPTPPGFAMK TENGVLRLGW NGRVVTVASA WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-1870292140375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976581.11e-147PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR72e-70SCL8_ARATH; Scarecrow-like protein 8
TrEMBLB4FTE31e-156B4FTE3_MAIZE; Uncharacterized protein
TrEMBLC4IZS71e-155C4IZS7_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P011e-152(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-61SCARECROW-like 8