PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462899940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 318aa    MW: 33723.5 Da    PI: 8.5583
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462899940genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26081.71.1e-25769163
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvy 63
               +CaaCk+lrrkC+++Cv+apyfp ++p+kfa vhk+FGasnv+k+l++lp+++r da+++l++
  462899940  7 PCAACKLLRRKCTQGCVFAPYFPPDSPAKFASVHKVFGASNVSKILNELPQSQRGDAVTALAF 69
               7***********************************************************987 PP

2DUF26048.62.3e-15951514096
     DUF260  40 snvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                 n++k+l++lp+++r da+ssl++eA+ar+rdPvyG+v+ i+ lq ++++++ ela+
  462899940  95 XNLSKILNELPQSQRGDAVSSLAFEADARLRDPVYGCVAYITVLQVRIKEARDELAA 151
                699*************************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.1956156IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-25769IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-1495150IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DSPAKFASVH KVFGASNVSK ILNELPQSQR  60
GDAVTALAFP XXXXXXXXXX XXXXXXXXXX XXXXXNLSKI LNELPQSQRG DAVSSLAFEA  120
DARLRDPVYG CVAYITVLQV RIKEARDELA AGAPPATSAR PRSRRSSPPL PPRRRSTSTT  180
STSTPPTCTS ASASGLISSS RWCSRFSSTT SSKAQQLAAA VEVAREQAGM MMRQAYAPGG  240
ATVPHDVAAQ YDGGFFLQQQ QQQSACASQA QTAVALTYQM DSSPPPSSCG QSPAEEVSQQ  300
QHTDGSDEGS GGVALPAC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3681349e-59AK368134.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2068L23.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-39ASYMMETRIC LEAVES 2-like 1