PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462899817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 363aa    MW: 39525.6 Da    PI: 8.7338
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462899817genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.72.2e-4091168178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  462899817  91 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 168
                6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.9E-3385153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.10389166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-3890171IPR004333Transcription factor, SBP-box
PfamPF031109.3E-3192165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
PESAPARHGV DAPAARRXXX XXXXXXXXXX XXXXXXXXXX XXXPSPPLLW DWADAAAPAS  60
GSSGEAPARR GGKEREGKRA KGEDGGGGEV RCQVEGCGLD LGGAKEYHRK HRVCEAHTKC  120
PRVVVAGQER RFCQQCSRFH ALSEFDQKKR SCRRRLSDHN ARRRKPQPDA FAFASARLPS  180
SLFDDRRQIS FVWNKAPLSH VRPFTSPWDS SSDFKLPHAK EIRETSAKLG TIAGQVHMEK  240
SHLSSAIPSL THGKDELLPV KGPDTSVTAS KFDGAQDLQR ALSLLSAGSC GFPDPVQQAS  300
CLIQFSGTSE NSGDLHSSHG GSSALASCAD EQHITPQSQL VRFTMDTGSN GNDSTFFGLN  360
QMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-2682165184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147164KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462899817
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0squamosa promoter-binding-like protein 4
SwissprotQ653Z52e-98SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU030.0K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-46squamosa promoter binding protein-like 2