PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462899661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 1145aa    MW: 128329 Da    PI: 6.8188
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462899661genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.41.5e-1042936603370
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +l + cA+av++gd + a +lL ++++++sp+gd++qRla++f+e+L+arla+++se+yk+l +++ts   + e l+a++l+  ++ +  +++   N++I
  462899661 293 NLCIYCAQAVATGDRRSAIELLRQIKQHSSPSGDATQRLAHCFAEGLEARLAGTGSEVYKSLMSKRTS---VMEYLKAYQLYLAACCFRMMAFKFSNKTI 389
                56688*********************************************************999999...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                 + ++g ++vHi+D+++ +G+QWp+Ll++La+R++gpp++RiTg++ p++g   + +leetg+rL++ A+++gvpf+f+  +a ++e+++ ++L+++p+E
  462899661 390 FNLIAGRKKVHIVDYGMHYGFQWPNLLRSLADREGGPPEVRITGIDLPQPGfrPAARLEETGRRLSSRARQFGVPFKFHS-IAAKWEMVRADDLNIDPDE 488
                **************************************************9*9***************************.799**************** PP

       GRAS 201 alaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +l+Vn +++l +llde  +l+s  +rd vL+ +++++P+ +++   + +hns+ F++rf ea+ yysa+fd ++a+ pr++e+r  vEr l+g ++ nvv
  462899661 489 VLIVNGIVHLANLLDEGNDLDSlsPRDVVLNNIRKMQPDAFILFVMNGSHNSPFFVTRFREAMFYYSAMFDIMDATTPRDNEQRLLVERDLFGSAALNVV 588
                ****************99999988**************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                aceg +r+er et+++W+ r ++aG++p+pl+ +a+k ++  +r  + + + ++ ++++l+ gWk+r L+++
  462899661 589 ACEGLDRVERPETYKQWHVRNQRAGLRPLPLDPEAVKHVRETVRSQYHKDFVIDMDRQWLLEGWKGRVLYAI 660
                ***********************************************888*******************985 PP

2GRAS349.55.3e-10776611363373
       GRAS    3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100 
                 +l + cA+av++gd + a +lL ++++++sp+gd++qRla++f+e+L+arla+++se+yk+l +++ts   + e l a+kl+  ++ +  +++   N+
  462899661  766 NLCIYCAQAVATGDRRSAMELLRQIKQHSSPSGDATQRLAHCFAEGLEARLAGTGSEVYKSLMSKRTS---VMEYLEAYKLYLAACCFRMMAFKFSNK 860 
                 56688*********************************************************999999...9************************** PP

       GRAS  101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196 
                 +I + ++g ++vHi+D+++ +G+QWp+Ll++La+R++gpp++RiTg++ p++g   + +leetg+rL++ A+++gvpf+f+  +a ++e++++++L++
  462899661  861 TIFNLIAGRKKVHIVDYGMHYGFQWPNLLRSLADREGGPPEVRITGIDLPQPGfrPAARLEETGRRLSSRARQFGVPFKFHS-IAAKWEMVRVDDLNI 957 
                 ****************************************************9*9***************************.799************ PP

       GRAS  197 kpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292 
                 +p+E+l+Vn +++l +llde  +l+s  +rd vL+ +++++P+ +++   + +hns+ F++rf ea+ yysa+fd ++a+ pr++e+r  vEr l+g 
  462899661  958 DPDEVLIVNGIVHLANLLDEGNDLDSlsPRDVVLNNIQKMRPDAFILFVMNGSHNSPFFVTRFREAMFYYSAMFDIMDATTPRDNEQRLLVERDLFGS 1055
                 ********************99999988********************************************************************** PP

       GRAS  293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                 ++ nvvaceg +r+er et+++W+ r  +aG++p+pl+ +a+k ++  +r  + + + ++ ++++l+ gWk+r L+++SaW
  462899661 1056 AALNVVACEGLDRVERPETYKQWHVRNLRAGLRPLPLDLEAVKHVRETVRSQYHKDFVIDMDRQWLLEGWKGRVLYAMSAW 1136
                 *****************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.52265644IPR005202Transcription factor GRAS
PfamPF035145.3E-102293660IPR005202Transcription factor GRAS
PROSITE profilePS5098562.0647381117IPR005202Transcription factor GRAS
PfamPF035141.8E-1047661136IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1145 aa     Download sequence    Send to blast
MAASPEESVE PFSPSLFLDL PPTPRPDGGG GGDPASSDDL VLPYISRMLM EDDIDDKFFY  60
QYPDHPVLLQ AQEPYAKILS DAATGSSSSS SGSATTNADG GSGRSTLSPS SSSGAAASGG  120
AIWPDDPIEL AQLLRSPPCP EMKVGLNGFT AEDVSSFFPA QDGATEGLQH SSIQLGNASS  180
AGDNRVHSPA TSEEEMKTKS TANLLSADGR KNRQDWDNLE AETGRNSKLM MREPEESGEI  240
VDKIVFNGYE LCLKEMQGLR IAMGSDAKKN TRKGDRKSGK GRQSTSQVVD LHNLCIYCAQ  300
AVATGDRRSA IELLRQIKQH SSPSGDATQR LAHCFAEGLE ARLAGTGSEV YKSLMSKRTS  360
VMEYLKAYQL YLAACCFRMM AFKFSNKTIF NLIAGRKKVH IVDYGMHYGF QWPNLLRSLA  420
DREGGPPEVR ITGIDLPQPG FRPAARLEET GRRLSSRARQ FGVPFKFHSI AAKWEMVRAD  480
DLNIDPDEVL IVNGIVHLAN LLDEGNDLDS LSPRDVVLNN IRKMQPDAFI LFVMNGSHNS  540
PFFVTRFREA MFYYSAMFDI MDATTPRDNE QRLLVERDLF GSAALNVVAC EGLDRVERPE  600
TYKQWHVRNQ RAGLRPLPLD PEAVKHVRET VRSQYHKDFV IDMDRQWLLE GWKGRVLYAI  660
DSKVKETVDE TLFSQRSGNG RGRKNRQDLD YLEAETGRNS KLMMREPEES GEIVDETVFN  720
GYELCLKEMQ GLRIAMGSDA KKNTRKGDRK SGKGRQSTSQ VVDLHNLCIY CAQAVATGDR  780
RSAMELLRQI KQHSSPSGDA TQRLAHCFAE GLEARLAGTG SEVYKSLMSK RTSVMEYLEA  840
YKLYLAACCF RMMAFKFSNK TIFNLIAGRK KVHIVDYGMH YGFQWPNLLR SLADREGGPP  900
EVRITGIDLP QPGFRPAARL EETGRRLSSR ARQFGVPFKF HSIAAKWEMV RVDDLNIDPD  960
EVLIVNGIVH LANLLDEGND LDSLSPRDVV LNNIQKMRPD AFILFVMNGS HNSPFFVTRF  1020
REAMFYYSAM FDIMDATTPR DNEQRLLVER DLFGSAALNV VACEGLDRVE RPETYKQWHV  1080
RNLRAGLRPL PLDLEAVKHV RETVRSQYHK DFVIDMDRQW LLEGWKGRVL YAMSAWVADD  1140
SKNFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4329611369374GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450063.10.0hypothetical protein SORBIDRAFT_05g027750
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein