PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462898146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28484.4 Da    PI: 8.7154
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462898146genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-31959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++g+lye++s
  462898146  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGQLYEFCS 59
               79***********************************************96 PP

2K-box84.62.1e-2885178998
      K-box   9 leeakaeslqqelakLkkeienLqreqR....hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                +e++  +s+++e+ kLk ++enLqr+qR    +llGedL++L +keL+qLe+qL++sl++iRs++++++l+q+ +lq++e++l e+nk+Lr+k 
  462898146  85 KENELVQSSRNEYLKLKGRVENLQRTQRqvelNLLGEDLGTLGVKELEQLEKQLDSSLRHIRSTRTQHMLDQLTDLQRREQMLCEANKCLRRKE 178
                46667899****************9999444458*********************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.814161IPR002100Transcription factor, MADS-box
CDDcd002653.67E-43277No hitNo description
SuperFamilySSF554556.93E-33288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-32323IPR002100Transcription factor, MADS-box
PfamPF003198.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.8E-2287177IPR002487Transcription factor, K-box
PROSITE profilePS5129714.8290186IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGQLYEFCSG  60
QSMTKSLERY QKCSYGGPDT AVQNKENELV QSSRNEYLKL KGRVENLQRT QRQVELNLLG  120
EDLGTLGVKE LEQLEKQLDS SLRHIRSTRT QHMLDQLTDL QRREQMLCEA NKCLRRKEKL  180
EETNQVQGQV VWEHGANLLG YERQSPQQAP SHVGNGFFHP LEAAAEPTLQ IGFAHEQMNN  240
FMPTWLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-3075175198Developmental protein SEPALLATA 3
4ox0_B2e-3075175198Developmental protein SEPALLATA 3
4ox0_C2e-3075175198Developmental protein SEPALLATA 3
4ox0_D2e-3075175198Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462898146
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803091.11e-160MADS-box transcription factor 8 isoform X2
SwissprotQ9SAR11e-156MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLA0A1D6ESU41e-160A0A1D6ESU4_MAIZE; MADS27
STRINGLPERR09G11910.11e-158(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.17e-91MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Jang YH, et al.
    Survey of rice proteins interacting with OsFCA and OsFY proteins which are homologous to the Arabidopsis flowering time proteins, FCA and FY.
    Plant Cell Physiol., 2009. 50(8): p. 1479-92
    [PMID:19561057]
  3. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  4. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]