PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462897739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 342aa    MW: 40556.9 Da    PI: 6.3321
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462897739genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.52.3e-25959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+ien +nrqvtfskRr g+lKKA+EL vLCda++ viif  +gk+yeyss
  462897739  9 KKIENPTNRQVTFSKRRMGLLKKANELAVLCDAQIGVIIFFGSGKMYEYSS 59
               68***********************************************96 PP

2K-box501.3e-17851541483
      K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                +++  +e++++k+e + Lq    +++GedL+ Lsl++  +LeqqLe sl k+R +K+ell +++ e++++
  462897739  85 QQKIIREMTRMKDERNRLQIIMSQYMGEDLTMLSLQDVSNLEQQLEFSLYKVRLRKQELLDQELLEMRNR 154
                578889************************************************************9987 PP

3K-box47.48e-172733421483
      K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                +++  +e++++k+e + Lq    +++GedL+ Lsl++  +LeqqLe sl k+R +K+ell +++ e++++
  462897739 273 QQKIIREMTRMKDERNRLQIIMSQYMGEDLTMLSLQDVSNLEQQLEFSLYKVRLRKQELLDQELLEMRNR 342
                578889**********************************************************999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.642161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-36160IPR002100Transcription factor, MADS-box
CDDcd002656.60E-35276No hitNo description
SuperFamilySSF554551.83E-28279IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.9E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-1481154IPR002487Transcription factor, K-box
PROSITE profilePS5129711.74885189IPR002487Transcription factor, K-box
PfamPF014862.2E-13269341IPR002487Transcription factor, K-box
PROSITE profilePS5129711.92273342IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRGRVELKK IENPTNRQVT FSKRRMGLLK KANELAVLCD AQIGVIIFFG SGKMYEYSSP  60
PWRIANIFDR YLKAPSTRFE EMDIQQKIIR EMTRMKDERN RLQIIMSQYM GEDLTMLSLQ  120
DVSNLEQQLE FSLYKVRLRK QELLDQELLE MRNRVCYAEF SIRPSLRHFL SESEPLSCDG  180
FVCSELQQEM HVSEVQSNQM CLMVRRTQSA EMVVNQKPFP WWDVGASQQQ LYGHEAESSM  240
TPLQLLPQLG EIANIFDRYL KAPSTRFEEM DIQQKIIREM TRMKDERNRL QIIMSQYMGE  300
DLTMLSLQDV SNLEQQLEFS LYKVRLRKQE LLDQELLEMR NR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-15160160MEF2 CHIMERA
6byy_B1e-15160160MEF2 CHIMERA
6byy_C1e-15160160MEF2 CHIMERA
6byy_D1e-15160160MEF2 CHIMERA
6bz1_A1e-15160160MEF2 CHIMERA
6bz1_B1e-15160160MEF2 CHIMERA
6bz1_C1e-15160160MEF2 CHIMERA
6bz1_D1e-15160160MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462897739
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020403834.11e-107MADS-box transcription factor 31
SwissprotQ84NC26e-94MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A1D6HRZ71e-105A0A1D6HRZ7_MAIZE; Protein TRANSPARENT TESTA 16
TrEMBLA0A2T8IDS81e-105A0A2T8IDS8_9POAL; Uncharacterized protein
TrEMBLA0A2T8IDT31e-105A0A2T8IDT3_9POAL; Uncharacterized protein
STRINGPavir.Gb00526.1.p1e-112(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.22e-38MIKC_MADS family protein
Publications ? help Back to Top
  1. Schilling S, et al.
    Non-canonical structure, function and phylogeny of the Bsister MADS-box gene OsMADS30 of rice (Oryza sativa).
    Plant J., 2015. 84(6): p. 1059-72
    [PMID:26473514]