PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462894627
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 91aa    MW: 10440 Da    PI: 5.9057
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462894627genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF503.9e-161312151
               HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51
               +KKA+ELSvLCdaev +i+fs++g+ly ++s
  462894627  1 MKKASELSVLCDAEVGLIVFSPRGRLYQFAS 31
               8****************************86 PP

2K-box15.28.8e-0763897197
      K-box 71 ellleqieelqkkekelqeenkaLrkk 97
               + l++qi+el++ke++l +en+ Lr +
  462894627 63 KKLMDQISELREKERNLMKENEVLRDQ 89
               6799*******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-4132IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-17165IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.657133IPR002100Transcription factor, MADS-box
PfamPF003191.6E-13129IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MKKASELSVL CDAEVGLIVF SPRGRLYQFA SATELQETID RYLNHTKGTP ANLKVDVPGI  60
EQKKLMDQIS ELREKERNLM KENEVLRDQA Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17176LREKER
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462894627
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0985091e-51FP098509.1 Phyllostachys edulis cDNA clone: bphylf003i12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022680391.11e-30MADS-box protein SOC1 isoform X3
SwissprotP0C5B24e-19MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBLI1HW382e-34I1HW38_BRADI; MADS-box transcription factor 22
STRINGBRADI3G00730.13e-35(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.18e-21AGAMOUS-like 20
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Bai Z, et al.
    The impact and origin of copy number variations in the Oryza species.
    BMC Genomics, 2016. 17: p. 261
    [PMID:27025496]
  4. Shibaya T, et al.
    Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice.
    Plant Cell Physiol., 2016. 57(9): p. 1828-38
    [PMID:27318280]
  5. Han Z,Zhang B,Zhao H,Ayaad M,Xing Y
    Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice.
    Front Plant Sci, 2016. 7: p. 1270
    [PMID:27621738]