PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462893065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 235aa    MW: 23642.5 Da    PI: 8.2879
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462893065genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601284.3e-4040124185
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++++reda++sl+yeA++r+rdPvyG+vgvi+ l+ 
  462893065  40 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKILNELHPSQREDAVNSLAYEANMRLRDPVYGCVGVISLLRI 124
                7*******************************************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.12339140IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-4040123IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MATSSSSSLP ATPGSVVTMA SSPTASSISG GSIGGGAGSP CAACKFLRRK CQPDCVFAPY  60
FPPDNPQKFV HVHRVFGASN VTKILNELHP SQREDAVNSL AYEANMRLRD PVYGCVGVIS  120
LLRITIPGRS RSYVAAAEAA AVAAVGSNGG GQAPMAGFVG NPVVPNCSQN FVNVGHSTAA  180
AAIGGAGFMQ HDAYSFGYSS GLASEHGGLG SLGNGPFMKC AAGTAGGDDR STVAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-48361507121LOB family transfactor Ramosa2.1
5ly0_B5e-48361507121LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462893065
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349331e-102AC134933.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0579A05, complete sequence.
GenBankAC1376171e-102AC137617.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0084P24, complete sequence.
GenBankAP0149611e-102AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962077.12e-82LOB domain-containing protein 6
RefseqXP_004962078.12e-82LOB domain-containing protein 6
RefseqXP_004962079.12e-82LOB domain-containing protein 6
RefseqXP_012700131.12e-82LOB domain-containing protein 6
SwissprotQ32SG38e-74LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3ZC405e-81K3ZC40_SETIT; Uncharacterized protein
STRINGSi024114m9e-82(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-48LBD family protein