PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462890127
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bHLH
Protein Properties Length: 229aa    MW: 25283.5 Da    PI: 6.627
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462890127genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.51.3e-1467119155
                CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
        HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  462890127  67 RKLSHNAYERDRRKQLNELYSSLRSLLPDA--DHTKKLSIPTTVSRVLKYIPELQ 119
                6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.75E-1664133IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.74E-1266122No hitNo description
PROSITE profilePS5088814.20866118IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.1E-1367134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.8E-1267119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.1E-1072124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDHQLFYDPF ASSISSLEAD IFSGGQLASP PWPDLDLDDD DIQGLSPPAA NATSSGGYGS  60
GGSGTHRKLS HNAYERDRRK QLNELYSSLR SLLPDADHTK KLSIPTTVSR VLKYIPELQK  120
QVDNLEKKKK ELTNASCKTG VLNTTESRTP VVSATCINDM EIMVQVSLPS NVAGTALPLS  180
KCIKVLENEG LHLISSSTYS TFENRTFYNL HLQVHNFSRR IPPFLDMLT
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462890127
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819629.11e-114protein IRON-RELATED TRANSCRIPTION FACTOR 2-like
SwissprotA2WZ602e-95IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2
TrEMBLA0A3L6PK741e-114A0A3L6PK74_PANMI; Transcription factor ORG3-like
STRINGSi002720m1e-112(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.15e-33bHLH family protein