PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462889973
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 86aa    MW: 9351.56 Da    PI: 9.0166
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462889973genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.37.1e-351284173
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPv 73
               +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeA+ar+rdP 
  462889973 12 PCAACKLLRRKCTQGCVFAPYFPPDNPSKFANVHRVFGASNVSKLLHELPHAQREDAVNSLAYEADARLRDPA 84
               7***********************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.9611186IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-341284IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MSSSSSSSSS SPCAACKLLR RKCTQGCVFA PYFPPDNPSK FANVHRVFGA SNVSKLLHEL  60
PHAQREDAVN SLAYEADARL RDPALR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126112e-66CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1369722e-66AC136972.3 Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic sequence, complete sequence.
GenBankAP0149592e-66AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466819.15e-45hypothetical protein SORBIDRAFT_01g014650
SwissprotQ8L8Q31e-41LBD25_ARATH; LOB domain-containing protein 25
TrEMBLM7YYN81e-45M7YYN8_TRIUA; Uncharacterized protein
STRINGSb01g014650.12e-44(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-41LOB domain-containing protein 25