PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462888136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 194aa    MW: 20816.3 Da    PI: 6.0744
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462888136genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260851e-2653124172
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardP 72 
                +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe+ r da+ss++  A+a + + 
  462888136  53 PCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPESSRADAVSSMLARAQADLLNA 124
                7****************************************************************9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.68352153IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-2753123IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MDYSNAGTGT ATAQQCYYRS ESPPSRVSSC SPPPPPAAQQ LVGNVAPTVV MSPCAACKIL  60
RRRCADGCVL APYFPPTEPA KFTTAHRVFG ASNIIKLLQD LPESSRADAV SSMLARAQAD  120
LLNAQAQHAN LLALLCVDMA NNRRDGPNSQ QQQQQFSPPC SGSGSDVGVG YHQMFYDSDL  180
DSATWPDHEA QLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-25521211079LOB family transfactor Ramosa2.1
5ly0_B7e-25521211079LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462888136
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9539375e-90EU953937.1 Zea mays clone 1449845 LOB domain protein 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987050.21e-85LOB domain-containing protein 1
SwissprotQ9LQR03e-38LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A368SSE33e-84A0A368SSE3_SETIT; Uncharacterized protein
TrEMBLK4AEH33e-84K4AEH3_SETIT; Uncharacterized protein
STRINGSi037280m5e-85(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-37LOB domain-containing protein 11