PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462887283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 570aa    MW: 64646.5 Da    PI: 6.8257
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462887283genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.55.2e-931905611373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL+ cA+av++g+++ a++lL++++++as +gd++qRla++f e+L+arla+++s++ k l  +  s   + e l a+kl+  +s ++k++ +    
  462887283 190 LRTLLVLCAQAVATGNHASADELLKKIKQHASAKGDATQRLAQCFCEGLEARLAGTGSKVNKFLMDRCPS---VREFLEAYKLYMAASGFYKVALVFNIT 286
                5789*********************************************************999999998...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +Il a+eg++r+Hi+ f+   GlQW++L+++La+R++gpp+++iT ++sp++    +e++eetg+rL++ A+++g+pf+f+  ++ ++e++ +e+L+++ 
  462887283 287 TILHAMEGKSRLHIVEFGTIFGLQWASLFRQLANREGGPPEVKITSIDSPQPRslPTERIEETGRRLSNCARNFGLPFKFHS-ITAAWEAVGIEDLNTNA 385
                ***************************************************9999***************************.6999************* PP

       GRAS 199 gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +E+l+Vn  ++l +l+de+  +++  +++ vL+ ++++ P+v++ +  +++  ++sFl+rf eal y +alfd+l+a++prese r ++E+ llgr + n
  462887283 386 DEVLVVNDLFNLSTLMDERIFVDNpsPKEMVLNNIRKMCPDVFIQSIVNCSS-GTSFLTRFREALFYLTALFDMLDATIPRESESRLVLEQDLLGRCVLN 484
                ******************987776559999**************99999998.789******************************************** PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ++aceg++     e++++W+ r ++aG++++pl+ ++++ ++  + k++ + + + +++++l+ gW++r L++ S W
  462887283 485 AIACEGEDLMDWPEKYRQWEVRNKRAGLRQLPLKPNIVQLVRDKVMKFHHKDFLLGKDDKWLIHGWMGRVLFAHSTW 561
                *************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.634164542IPR005202Transcription factor GRAS
PfamPF035141.8E-90190561IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MAITPEEFFV ESLMEQIPPS PSAFINLPQS HAGGGENQLT MDDSVLPHIS RVLMEDEIED  60
SILYSDHPAL LKVQRPFAQI LFSDSFRTNK YSTGPYASTP LLVTVRESIA HKVLKKRENR  120
DKHLEDEVGR ARKSTSYSRM KEMEEICELF DDLMLHSSEA CIRDMKKLRV AMDNVILKHA  180
SKATMDTVDL RTLLVLCAQA VATGNHASAD ELLKKIKQHA SAKGDATQRL AQCFCEGLEA  240
RLAGTGSKVN KFLMDRCPSV REFLEAYKLY MAASGFYKVA LVFNITTILH AMEGKSRLHI  300
VEFGTIFGLQ WASLFRQLAN REGGPPEVKI TSIDSPQPRS LPTERIEETG RRLSNCARNF  360
GLPFKFHSIT AAWEAVGIED LNTNADEVLV VNDLFNLSTL MDERIFVDNP SPKEMVLNNI  420
RKMCPDVFIQ SIVNCSSGTS FLTRFREALF YLTALFDMLD ATIPRESESR LVLEQDLLGR  480
CVLNAIACEG EDLMDWPEKY RQWEVRNKRA GLRQLPLKPN IVQLVRDKVM KFHHKDFLLG  540
KDDKWLIHGW MGRVLFAHST WVANDVPFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-291945618374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1212217LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964176.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-111GRAS family protein