PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462887107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family WOX
Protein Properties Length: 106aa    MW: 12289 Da    PI: 9.7781
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462887107genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665e-211877357
               --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  462887107 18 TRWCPTPEQLMILEEMYRGgLRTPNASQIQQITAHLssygRIEGKNVFYWFQNHKARDRQ 77
               7*****************99*************************************996 PP

2Wus_type_Homeobox121.92.6e-391878464
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       tRW+PtpeQ++iLee+y+ GlrtPn+++iq+ita+L++yG+ie+kNVfyWFQN+kaR+rqk
          462887107 18 TRWCPTPEQLMILEEMYRGGLRTPNASQIQQITAHLSSYGRIEGKNVFYWFQNHKARDRQK 78
                       8***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.4E-41682IPR001356Homeobox domain
SuperFamilySSF466894.19E-121781IPR009057Homeodomain-like
PfamPF000461.1E-181877IPR001356Homeobox domain
CDDcd000869.22E-51878No hitNo description
Gene3DG3`s\vl VE`s\vl V>7.4E-81977IPR009057Homeodomain-like
PROSITE profilePS500719.7662378IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MPSQPPQRAH EQLPVGPTRW CPTPEQLMIL EEMYRGGLRT PNASQIQQIT AHLSSYGRIE  60
GKNVFYWFQN HKARDRQKLR RRLCMSHHLL SASCAAAHYY YGGHAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0401841e-92BT040184.1 Zea mays full-length cDNA clone ZM_BFc0070F13 mRNA, complete cds.
GenBankKJ7269461e-92KJ726946.1 Zea mays clone pUT3492 HB transcription factor (HB82) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440499.12e-49hypothetical protein SORBIDRAFT_09g002010
SwissprotA2XZR32e-48WOX2_ORYSI; Putative WUSCHEL-related homeobox 2
TrEMBLC5YZ142e-49C5YZ14_SORBI; Putative uncharacterized protein Sb09g002010
TrEMBLM8AVP11e-49M8AVP1_TRIUA; Putative WUSCHEL-related homeobox 2
TrEMBLR7VZP32e-49R7VZP3_AEGTA; Putative WUSCHEL-related homeobox 2
TrEMBLW5ANF92e-49W5ANF9_WHEAT; Uncharacterized protein
STRINGSb09g002010.16e-49(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-42WOX family protein