PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462887068
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bZIP
Protein Properties Length: 320aa    MW: 33684 Da    PI: 11.1162
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462887068genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.6e-13240293457
                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                ++r++r++kNRe+A rsR RK+a+++eLe  v +Le+e  +L  e ee +++  
  462887068 240 VQRQKRMIKNRESAARSRDRKQAYVAELESQVSQLEEEQAELLREQEEQNQKRL 293
                58**************************************99987776665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-8237301IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611239291IPR004827Basic-leucine zipper domain
PfamPF001701.6E-11240292IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10241290No hitNo description
CDDcd147073.48E-18241288No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-12242295No hitNo description
PROSITE patternPS000360244259IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
GLLSSPRSAS PRVESVGGCF AALLPPPSLA SSTNQPQHFL PRSSLSPSPE THRRSNGAPR  60
GAVKAARRGA AHLATSRGAV SGVAAWPVVA GDAVVVVAAA AGGRGVRGPR ALQEQQRHRI  120
HEHGRHHAQH LRDPAPAAAA RRTSEEVWKE ISAAGGGGVL TAPAPPPPPA ATGAGAGGAG  180
GASEMTLEDF LARDTGTAIV PVVEASMALG FPDGGDVAPV GGGGRARKRA PMDPMDRAVV  240
QRQKRMIKNR ESAARSRDRK QAYVAELESQ VSQLEEEQAE LLREQEEQNQ KRLKELMEKA  300
VPAIRSKPLQ DLRRTNSMEW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149687.15e-67G-box-binding factor 4
TrEMBLB6TGZ05e-67B6TGZ0_MAIZE; G-box-binding factor 4
STRINGGRMZM2G132868_P011e-66(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-11bZIP family protein