PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462881795
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 188aa    MW: 22073.4 Da    PI: 8.196
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462881795genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.11.1e-23958150
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
               krien ++rq tf kRr g++KKA ELSvLCd++ ++++fs +gkly y 
  462881795  9 KRIENPTQRQSTFYKRRDGLFKKARELSVLCDVDLLLLLFSASGKLYHYL 58
               79*********************************************996 PP

2K-box31.76.5e-1272169198
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                y++++++++++  +++ + ela++ +  e L+re+R +  +d e+ ++  L+ Le++Le ++ k+R  K++ +  +i++l +  +  qee   L  k+
  462881795  72 YEAATHTKVWTDIQQERRAELAQVAQMCELLERELRFMTVDDGEQYTVPSLEMLEHNLEAAMHKVRCEKDRKIGGEINYLENVIRGRQEERYGLCDKV 169
                56677888*************************************************************************99999999988887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.483161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-28286IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-23323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-233859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1383169IPR002487Transcription factor, K-box
PROSITE profilePS512979.84785175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MGRGRSEIKR IENPTQRQST FYKRRDGLFK KARELSVLCD VDLLLLLFSA SGKLYHYLSP  60
TVPSVKELVE RYEAATHTKV WTDIQQERRA ELAQVAQMCE LLERELRFMT VDDGEQYTVP  120
SLEMLEHNLE AAMHKVRCEK DRKIGGEINY LENVIRGRQE ERYGLCDKVS NRLCAPLIFS  180
YFRSYFLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-14180184MEF2 CHIMERA
6byy_B1e-14180184MEF2 CHIMERA
6byy_C1e-14180184MEF2 CHIMERA
6byy_D1e-14180184MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462881795
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5570511e-161EU557051.1 Hordeum vulgare MIKC-type MADS-box transcription factor WM16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644649.11e-106PREDICTED: MADS-box transcription factor 32 isoform X1
RefseqXP_015693732.11e-106PREDICTED: MADS-box transcription factor 32 isoform X2
SwissprotQ8S1511e-104MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLA0A3Q8BBY81e-105A0A3Q8BBY8_BAMML; MADS32
TrEMBLJ3L3N91e-105J3L3N9_ORYBR; Uncharacterized protein
STRINGOB01G38450.11e-106(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.24e-22MIKC_MADS family protein
Publications ? help Back to Top
  1. Wang H, et al.
    OsMADS32 interacts with PI-like proteins and regulates rice flower development.
    J Integr Plant Biol, 2015. 57(5): p. 504-13
    [PMID:25081486]
  2. Khanday I, et al.
    Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties.
    Plant Physiol., 2016. 172(1): p. 372-88
    [PMID:27457124]