PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462880894
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 608aa    MW: 69444.4 Da    PI: 6.6945
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462880894genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS254.83.2e-782505973373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cA+av++++++ + ++L++++++as +gd+ qRla++f+++L+arl+++ ++l k l +++ s   ++e l+a+k+f  v+ + +++      +I
  462880894 250 TLLIHCAQAVAAHNHTIVIEMLKKIKHHASATGDARQRLAQCFAKGLEARLLDTRTQLWKLLMTERPS---VKEFLKAYKMFRAVCCFNNITLTFSIMTI 346
                68*********************************************************999998888...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEal 202
                ++a+ g++r+Hi+ +++ +G+QW+ +++ La+R+                  ++++ee g+ L+k A+++g+pf+f+  +++++e++++++L+++ +E+l
  462880894 347 MDAIVGKRRLHIVVYGMHYGFQWAIFIRWLAERN------------------AQKIEEQGRWLSKCANKFGLPFKFHS-ITTDWEKVSIKDLHIEVDEVL 427
                ********************************94..................4578999*******************.6999***************** PP

       GRAS 203 aVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                +Vn  ++ ++l des   ++  +rd+vL+ +++++P+v++ +  ++++ ++sFl rf eal +y+alfd+++a++prese r ++E+ +lgr++ n++ac
  462880894 428 IVNDLFNFMSLRDESIFFDKpsPRDTVLNNIRKMRPDVFIQSVVNCSY-GSSFLSRFREALFHYTALFDMFDATMPRESESRLVLEQGWLGRHVLNIIAC 526
                ***************97776669*************************.679************************************************ PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ega+ + r e++++W++r ++aGF+++pl+  +a  ++  ++++k d +++ e+ ++l++gW++r+L++ SaW
  462880894 527 EGADLVDRPEKYRQWHARNQRAGFRQLPLNPGIARVIRDKVKMHK-D-FMLSEDGQWLLQGWMGRTLFAHSAW 597
                ********************************************9.5.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.587222580IPR005202Transcription factor GRAS
PfamPF035141.1E-75250597IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MATTPEEFFA QGLIEPTPPS PSVFLDLPVT PDGNTEGSLY PDDMVPSSIF HMLTEDDISN  60
GKLLQQSSDD PTLLQAQQPV VQILSSHSFA ANNDNSCNTE GAEELTTGDG GDQSSLSSSF  120
SNGVDVVGAF FKGTEDAIKF LPRDNSFRSD DQVKEKIFIE SMNHKATKKR YNRGDYLEED  180
VRSTRKAMMT MMEEQEENGS HEILEEMMLC GYETCTKEME NMRISLNNDG KKNKLKSCSK  240
AAKDVVDLPT LLIHCAQAVA AHNHTIVIEM LKKIKHHASA TGDARQRLAQ CFAKGLEARL  300
LDTRTQLWKL LMTERPSVKE FLKAYKMFRA VCCFNNITLT FSIMTIMDAI VGKRRLHIVV  360
YGMHYGFQWA IFIRWLAERN AQKIEEQGRW LSKCANKFGL PFKFHSITTD WEKVSIKDLH  420
IEVDEVLIVN DLFNFMSLRD ESIFFDKPSP RDTVLNNIRK MRPDVFIQSV VNCSYGSSFL  480
SRFREALFHY TALFDMFDAT MPRESESRLV LEQGWLGRHV LNIIACEGAD LVDRPEKYRQ  540
WHARNQRAGF RQLPLNPGIA RVIRDKVKMH KDFMLSEDGQ WLLQGWMGRT LFAHSAWVAA  600
EVPERKRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-192525978374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677893.10.0PREDICTED: scarecrow-like protein 33 isoform X3
RefseqXP_008677891.10.0PREDICTED: scarecrow-like protein 34 isoform X1
TrEMBLK7TQL60.0K7TQL6_MAIZE; GRAS transcription factor
STRINGGRMZM2G106356_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-104GRAS family protein