PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462879521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 379aa    MW: 40823.6 Da    PI: 9.3527
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462879521genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.7e-42176252278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                CqvegC++dls+ak+yhr+h+vCe+hsk+p+v+v gle+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  462879521 176 CQVEGCKVDLSSAKDYHRKHRVCEAHSKTPKVIVGGLERRFCQQCSRFHALSEFDQKKRSCRRRLNDHNARRRKPQP 252
                **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-34169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.624173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-40175255IPR004333Transcription factor, SBP-box
PfamPF031104.2E-32176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MGSFGMDWNQ KGSVLWDWEN SPPIGANANE NLKILPQAEP KFAGHESVHS SCGTFSSSSE  60
MGYCSSKSSI ASIDSSPKVG DNRELNFAPV KAPDKKTGKK ADLGKVDTAR SSPSSVIAVS  120
SGEPVIGLKL GKRTYFEDVC GGQSVKSSPL DTSAVTPPAP PGKKAKVAQN TQNSYCQVEG  180
CKVDLSSAKD YHRKHRVCEA HSKTPKVIVG GLERRFCQQC SRFHALSEFD QKKRSCRRRL  240
NDHNARRRKP QPEPISYSAS RLSAVFYGAD ASAVVSNSNG APDLQRALSL LSNSSADAAS  300
GQPIPQLHPS MTTIASSSNP VMQGSSPGLR QDGTALDHQA RFQAFDPLNN GSNIATPHQL  360
HLLKPPSYDS YPSHYDQMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRRRLNDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462879521
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826432.11e-144squamosa promoter-binding-like protein 3
RefseqXP_025826439.11e-144squamosa promoter-binding-like protein 3
RefseqXP_025826447.11e-144squamosa promoter-binding-like protein 3
SwissprotA2X0Q61e-102SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-102SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A1E5VW920.0A0A1E5VW92_9POAL; Squamosa promoter-binding-like protein 12
STRINGPavir.Ab00358.1.p1e-134(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-42squamosa promoter binding protein-like 2