PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462876955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25881.6 Da    PI: 7.6652
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462876955genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.92.8e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtfskRrng+lKKA E+SvLCdaev  +ifss gkly+++s
  462876955  9 KRIENSTNRQVTFSKRRNGLLKKAREISVLCDAEVGAVIFSSAGKLYDFCS 59
               79***********************************************96 PP

2K-box707.6e-2485183199
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                yq++sgk l+++k++s + e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L+++l++  +k  e++ + +++  + e+e++    +L+++ +
  462876955  85 YQTNSGKILWDEKHKSISAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGLTNLNEKLVEHWERRMRNNTMLEDENKLLAFKLHQQDA 183
                89999999***************************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.983161IPR002100Transcription factor, MADS-box
CDDcd002654.00E-43294No hitNo description
SuperFamilySSF554553.14E-302109IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014869.0E-1496178IPR002487Transcription factor, K-box
PROSITE profilePS5129712.30498184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRNGLLK KAREISVLCD AEVGAVIFSS AGKLYDFCSP  60
KTSYVPYLFP LRFPVPALSK ILEKYQTNSG KILWDEKHKS ISAEIDRIKK ENDNMQIELR  120
HLKGEDLNSL QPKELIMIEE ALDNGLTNLN EKLVEHWERR MRNNTMLEDE NKLLAFKLHQ  180
QDAELSGSMR DLELGYHPDR DFEAQMPITF RVQPSHPNLQ DNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q2e-17160160Myocyte-specific enhancer factor 2B
1tqe_R2e-17160160Myocyte-specific enhancer factor 2B
1tqe_S2e-17160160Myocyte-specific enhancer factor 2B
6byy_A2e-17160160MEF2 CHIMERA
6byy_B2e-17160160MEF2 CHIMERA
6byy_C2e-17160160MEF2 CHIMERA
6byy_D2e-17160160MEF2 CHIMERA
6bz1_A2e-17160160MEF2 CHIMERA
6bz1_B2e-17160160MEF2 CHIMERA
6bz1_C2e-17160160MEF2 CHIMERA
6bz1_D2e-17160160MEF2 CHIMERA
6c9l_A2e-17160160Myocyte-specific enhancer factor 2B
6c9l_B2e-17160160Myocyte-specific enhancer factor 2B
6c9l_C2e-17160160Myocyte-specific enhancer factor 2B
6c9l_D2e-17160160Myocyte-specific enhancer factor 2B
6c9l_E2e-17160160Myocyte-specific enhancer factor 2B
6c9l_F2e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules (whorl 2). {ECO:0000269|PubMed:14704206}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462876955
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU7403221e-145KU740322.1 Aristida purpurea PISTILLATA-like MADS-box transcription factor PI-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816957.11e-141MADS-box transcription factor 2
SwissprotQ407021e-137MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLA0A2S3HPC71e-139A0A2S3HPC7_9POAL; Uncharacterized protein
TrEMBLA0A3L6RIC41e-139A0A3L6RIC4_PANMI; MADS-box transcription factor 2
STRINGSb03g041860.11e-139(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-68MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]