PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462875596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 340aa    MW: 37273 Da    PI: 9.9377
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462875596genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.4e-40228305178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC++dls+ak+yhr+hk+Ce+hskap+v+v+gle+rfCqqCsr h l efD++krsCrrrL++hn+rrrk++a
  462875596 228 CCQVEGCNVDLSSAKDYHRKHKICEAHSKAPKVVVAGLERRFCQQCSRLHGLAEFDQNKRSCRRRLSHHNARRRKPHA 305
                6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-33221290IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.983226303IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.19E-37228308IPR004333Transcription factor, SBP-box
PfamPF031109.3E-32229302IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MLDGSGLMVF YLGQGKSGHE KGERAQSSKR MASMFPHTHL WAAVEIVNSG MGSSGMNWNH  60
KNSMVWEWGN LTPSPNAIEN LNSGALPKPR DADTVATRYG SVSSSDAAFT SSSEVGHGSS  120
KSSLSASIGS PLREGNVLEF NFAAVSRRDM NMENVKASRV DDLGTSSPSM MAICHREPLI  180
SLRLGKRNYF ENVRGGQDVN NSATTGATCP STVVKKTKES QQSTQNSCCQ VEGCNVDLSS  240
AKDYHRKHKI CEAHSKAPKV VVAGLERRFC QQCSRLHGLA EFDQNKRSCR RRLSHHNARR  300
RKPHADAISF SSSRLSTMLY SSMETLVSSC VWKLLRLLPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-282293021184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462875596
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438971.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_015643452.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643454.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643455.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643456.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643457.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643458.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643459.11e-100squamosa promoter-binding-like protein 12
RefseqXP_015643461.11e-100squamosa promoter-binding-like protein 12
RefseqXP_021305400.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305401.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305402.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305403.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305404.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305405.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305406.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305407.11e-100squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_021305408.11e-100squamosa promoter-binding-like protein 12 isoform X2
RefseqXP_025882366.11e-100squamosa promoter-binding-like protein 12
RefseqXP_025882367.11e-100squamosa promoter-binding-like protein 12
SwissprotA2YGR51e-101SPL12_ORYSI; Squamosa promoter-binding-like protein 12
SwissprotQ5Z8181e-101SPL12_ORYSJ; Squamosa promoter-binding-like protein 12
TrEMBLA0A3Q8AKY81e-121A0A3Q8AKY8_9POAL; Squamosa-promoter binding protein-like protein
STRINGONIVA06G29160.11e-104(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-36squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Liu Q, et al.
    The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f.
    J Integr Plant Biol, 2015. 57(10): p. 819-29
    [PMID:25677853]