PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462874353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 25443.8 Da    PI: 7.7861
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462874353genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtfskRr+gi KKA E+ vLCdaev v+ifss gkly+y++
  462874353  9 KRIENSTNRQVTFSKRRAGIVKKAREIGVLCDAEVGVVIFSSAGKLYDYCT 59
               79***********************************************96 PP

2K-box57.46.2e-2071163191
      K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqR..hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                yq++sgk l+++k++sl+ e++++kke++n+q e+R  hl+GedL+sL+ +eL  +e++L+++ ++ R+k++++++ + ++ ++ e+e++  +
  462874353  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQIELRlvHLKGEDLNSLQPRELIAIEEALQNGQTNLREKQMDHWRLHKRNGKMLEDEHKLLT 163
                89999999************************998888*******************************************999999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
CDDcd002654.58E-42280No hitNo description
SuperFamilySSF554551.44E-32295IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.8E-1182164IPR002487Transcription factor, K-box
PROSITE profilePS5129711.35884172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGIVK KAREIGVLCD AEVGVVIFSS AGKLYDYCTP  60
RTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLVHL KGEDLNSLQP  120
RELIAIEEAL QNGQTNLREK QMDHWRLHKR NGKMLEDEHK LLTLRAHQQD VELSGGMRDL  180
DIGYQYHQVH HDRDFTSQMP FTFRVQPSHP NLQEDEDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-19171169Myocyte-specific enhancer factor 2B
1tqe_Q8e-19171169Myocyte-specific enhancer factor 2B
1tqe_R8e-19171169Myocyte-specific enhancer factor 2B
1tqe_S8e-19171169Myocyte-specific enhancer factor 2B
6c9l_A8e-19171169Myocyte-specific enhancer factor 2B
6c9l_B8e-19171169Myocyte-specific enhancer factor 2B
6c9l_C8e-19171169Myocyte-specific enhancer factor 2B
6c9l_D8e-19171169Myocyte-specific enhancer factor 2B
6c9l_E8e-19171169Myocyte-specific enhancer factor 2B
6c9l_F8e-19171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462874353
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269300.0KJ726930.1 Zea mays clone pUT3475 MADS transcription factor (MADS29) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.11e-144MADS-box transcription factor 4
SwissprotQ407031e-132MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A127J9I81e-142A0A127J9I8_9POAL; PISTILLATA-like MADS-box transcription factor PI-1
STRINGSi023214m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.12e-71MIKC_MADS family protein
Publications ? help Back to Top
  1. Ronai Z, et al.
    Transcription factor binding study by capillary zone electrophoretic mobility shift assay.
    Electrophoresis, 2003. 24(1-2): p. 96-100
    [PMID:12652578]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Kang HG,An G
    Morphological alterations by ectopic expression of the rice OsMADS4 gene in tobacco plants.
    Plant Cell Rep., 2005. 24(2): p. 120-6
    [PMID:15703945]
  4. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  5. Chen C, et al.
    Adapting rice anther culture to gene transformation and RNA interference.
    Sci. China, C, Life Sci., 2006. 49(5): p. 414-28
    [PMID:17172048]
  6. Yoshida H, et al.
    superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
    Plant Biotechnol. J., 2007. 5(6): p. 835-46
    [PMID:17764519]
  7. Yao SG,Ohmori S,Kimizu M,Yoshida H
    Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
    Plant Cell Physiol., 2008. 49(5): p. 853-7
    [PMID:18378529]
  8. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  9. Wang H, et al.
    OsMADS32 interacts with PI-like proteins and regulates rice flower development.
    J Integr Plant Biol, 2015. 57(5): p. 504-13
    [PMID:25081486]