PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462873030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 286aa    MW: 31309.1 Da    PI: 9.005
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462873030genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.16e-391691378
               SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP  3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
               +vegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  462873030 16 HVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 91
               59***********************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.1281289IPR004333Transcription factor, SBP-box
PfamPF031101.0E-291688IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.1E-301676IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-361794IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MDPSPYIPIQ PKGGNHVEGC GLDLGGAKEY HRKHRVCEAH TKCPRVVVAG QERRFCQQCS  60
RFHALSEFDQ KKRSCRRRLS DHNARRRKPQ PDAFAFASAR LPSSLFDDRR QISFVWNKAP  120
LSHVRPFTSP WDSTSDFKLP HAKEIREISA KVGTIAGQVH LDKSHLSSAV PSLSHGKDEL  180
LPVKGPNTSV TASKFDGAPD LQRALSLLSA GSCGFPDPVQ QASCLIQFSG ASENSSDLRS  240
SHGGSSALAS CADEQHIAPQ SQLVRFTMDT GSNGYDSTFF GLNQIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2317881384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17087KKRSCRRRLSDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462873030
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.11e-178squamosa promoter-binding-like protein 4
SwissprotQ653Z52e-97SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU031e-177K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m1e-178(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-44squamosa promoter binding protein-like 10