PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462867737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 185aa    MW: 21639.9 Da    PI: 9.2365
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462867737genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.29.1e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               kri+n  nrqvtfskRr+g+lKKA+EL vLCd++ av ifs++gkl+eys+
  462867737  9 KRIDNRVNRQVTFSKRRKGLLKKAHELAVLCDVQLAVFIFSERGKLFEYSN 59
               79***********************************************95 PP

2K-box41.94.4e-1581144972
      K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 
                 ++++ ++l  e+a+L +e e+L++++R  +GedL+sLs+ eL +Leq L++ l+k+R++K   
  462867737  81 EAHRQDQQLLMEMARLTNEKEQLESNIRISKGEDLSSLSVDELSELEQYLQSVLSKVRARKILS 144
                34556778889**************************************************654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.417161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-29291IPR002100Transcription factor, MADS-box
CDDcd002652.31E-35279No hitNo description
PRINTSPR004043.7E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-283859IPR002100Transcription factor, MADS-box
PfamPF014866.7E-1382179IPR002487Transcription factor, K-box
PROSITE profilePS5129710.46986185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MGRGRVELKR IDNRVNRQVT FSKRRKGLLK KAHELAVLCD VQLAVFIFSE RGKLFEYSNP  60
PCSMSDLIRR YEIASNTQLH EAHRQDQQLL MEMARLTNEK EQLESNIRIS KGEDLSSLSV  120
DELSELEQYL QSVLSKVRAR KILSSLIEVT NCLWQHELQT QLLDDLRRKV LIVNHEQSHV  180
VMQTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-17183176MEF2C
5f28_B4e-17183176MEF2C
5f28_C4e-17183176MEF2C
5f28_D4e-17183176MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462867737
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025811394.15e-62MADS-box transcription factor 30-like
SwissprotQ8VWM85e-56M17_MAIZE; MADS-box protein ZMM17
TrEMBLA0A2S3HH793e-60A0A2S3HH79_9POAL; Uncharacterized protein
TrEMBLA0A2T7DVG83e-60A0A2T7DVG8_9POAL; Uncharacterized protein
STRINGPavir.J10823.1.p6e-60(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-32AGAMOUS-like 8