PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462867224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 166aa    MW: 17815.2 Da    PI: 7.0008
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462867224genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.7e-45141131100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+ +lal+k+e
  462867224  14 PCASCKLLRRRCTEECVFAPYFPPEDPHKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQLQMQLALAKAE 113
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.74813114IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4414111IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAGSGSSTGG TSPPCASCKL LRRRCTEECV FAPYFPPEDP HKFAIVHKVF GASNVSKMLQ  60
ELPAQQRADA VSSLVYEANA RMRDPVYGCV GAISYLQQQV SQLQMQLALA KAEILCVQMQ  120
QNDGQQGHPT AAPASAKQQL QHQEMDGEAY GSIASNVNAS GFIHMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4941151112LOB family transfactor Ramosa2.1
5ly0_B1e-4941151112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462867224
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008521e-112FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242550.12e-71LOB domain-containing protein 12
RefseqXP_006350925.12e-71PREDICTED: LOB domain-containing protein 12-like
RefseqXP_012844404.18e-72PREDICTED: LOB domain-containing protein 12-like, partial
SwissprotQ8LBW34e-69LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1E5V6L62e-73A0A1E5V6L6_9POAL; LOB domain-containing protein 12
STRINGSolyc06g082310.2.17e-71(Solanum lycopersicum)
STRINGPGSC0003DMT4000782567e-71(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-59LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]