PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462867224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 166aa    MW: 17815.2 Da    PI: 7.0008
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462867224genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.7e-45141131100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++ql+ +lal+k+e
  462867224  14 PCASCKLLRRRCTEECVFAPYFPPEDPHKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQLQMQLALAKAE 113
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.74813114IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4414111IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAGSGSSTGG TSPPCASCKL LRRRCTEECV FAPYFPPEDP HKFAIVHKVF GASNVSKMLQ  60
ELPAQQRADA VSSLVYEANA RMRDPVYGCV GAISYLQQQV SQLQMQLALA KAEILCVQMQ  120
QNDGQQGHPT AAPASAKQQL QHQEMDGEAY GSIASNVNAS GFIHMA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008521e-112FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242550.19e-72PREDICTED: LOB domain-containing protein 12
RefseqXP_006350925.19e-72PREDICTED: LOB domain-containing protein 12-like
RefseqXP_012844404.14e-72PREDICTED: LOB domain-containing protein 12-like, partial
RefseqXP_014661028.12e-71PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-70LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK4CA901e-71K4CA90_SOLLC; Uncharacterized protein
TrEMBLM1CZR11e-71M1CZR1_SOLTU; Uncharacterized protein
STRINGSolyc06g082310.2.13e-71(Solanum lycopersicum)
STRINGPGSC0003DMT4000782563e-71(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-59LBD family protein