PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462865445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 26002.8 Da    PI: 8.0731
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462865445genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.24.3e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  462865445  9 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
               79***********************************************96 PP

2K-box49.61.7e-17133223195
      K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                yq+s++++  e ++ ++   e++++k+e+++L++ +R++ G+dL+sL+l +++ LeqqLe s++     K+ell++q+++l++ke+ l+++n  L 
  462865445 133 YQHSTNNHfEEINHDQQIFMEMTRMKNEVDQLETGLRRFTGDDLSSLTLTDINDLEQQLELSVT-----KHELLTQQLDNLRRKEHILEDQNSILC 223
                677777777788889999******************************************9995.....9**********************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.282161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-29261IPR002100Transcription factor, MADS-box
CDDcd002659.51E-38260No hitNo description
PRINTSPR004042.1E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-16143224IPR002487Transcription factor, K-box
PROSITE profilePS5129710.054147225IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
TSRLGFVPRS SPSNLCCLRT HPASCSLQYV LKCRSISVFL STQDIIFSVQ FDLSRFAQKQ  120
LHVAFLRELI EQYQHSTNNH FEEINHDQQI FMEMTRMKNE VDQLETGLRR FTGDDLSSLT  180
LTDINDLEQQ LELSVTKHEL LTQQLDNLRR KEHILEDQNS ILCRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-18159159MEF2C
5f28_B6e-18159159MEF2C
5f28_C6e-18159159MEF2C
5f28_D6e-18159159MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462865445
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9622532e-80EU962253.1 Zea mays clone 241317 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794853.16e-85MADS-box protein ZMM17-like
SwissprotQ6H7115e-50MAD29_ORYSJ; MADS-box transcription factor 29
TrEMBLA0A2S3GLI71e-83A0A2S3GLI7_9POAL; Uncharacterized protein
TrEMBLA0A2S3GM151e-83A0A2S3GM15_9POAL; Uncharacterized protein
TrEMBLA0A2T7F2H11e-83A0A2T7F2H1_9POAL; Uncharacterized protein
TrEMBLA0A2T7F2H41e-83A0A2T7F2H4_9POAL; Uncharacterized protein
STRINGPavir.Ab00475.1.p3e-83(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-35MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li M,Sun P,Zhou H,Chen S,Yu S
    Identification of quantitative trait loci associated with germination using chromosome segment substitution lines of rice (Oryza sativa L.).
    Theor. Appl. Genet., 2011. 123(3): p. 411-20
    [PMID:21512773]
  3. Yin LL,Xue HW
    The MADS29 transcription factor regulates the degradation of the nucellus and the nucellar projection during rice seed development.
    Plant Cell, 2012. 24(3): p. 1049-65
    [PMID:22408076]
  4. Yang X, et al.
    Live and let die - the B(sister) MADS-box gene OsMADS29 controls the degeneration of cells in maternal tissues during seed development of rice (Oryza sativa).
    PLoS ONE, 2012. 7(12): p. e51435
    [PMID:23251532]
  5. Nayar S,Sharma R,Tyagi AK,Kapoor S
    Functional delineation of rice MADS29 reveals its role in embryo and endosperm development by affecting hormone homeostasis.
    J. Exp. Bot., 2013. 64(14): p. 4239-53
    [PMID:23929654]
  6. Nayar S,Kapoor M,Kapoor S
    Post-translational regulation of rice MADS29 function: homodimerization or binary interactions with other seed-expressed MADS proteins modulate its translocation into the nucleus.
    J. Exp. Bot., 2014. 65(18): p. 5339-50
    [PMID:25096923]
  7. Schilling S, et al.
    Non-canonical structure, function and phylogeny of the Bsister MADS-box gene OsMADS30 of rice (Oryza sativa).
    Plant J., 2015. 84(6): p. 1059-72
    [PMID:26473514]