PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462863009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 148aa    MW: 16489.1 Da    PI: 4.0042
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462863009genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.37.5e-1224062100
     DUF260  62 vyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 yeA+ar++dP+yG+v++i++lqqq+  l+a+l++lk++
  462863009   2 SYEAQARLQDPIYGCVAHIFSLQQQVVLLQAQLESLKAQ 40 
                7*********************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.7E-9138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSYEAQARLQ DPIYGCVAHI FSLQQQVVLL QAQLESLKAQ TTQGYGDGSL TSIPQNGNCE  60
RLTPSMQDGQ FFVHPTMPSD NSLVKEEIQL YFAKDCFTSE STQYSDGYEQ DLCMPDYSSS  120
NPSCTAQRSG YHDIDDLQSV AFAYLNQA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6726701e-173JN672670.1 Eragrostis tef bio-material GRIN PI524434 clone Tefdw3b, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974249.15e-75PREDICTED: LOB domain-containing protein 29-like
TrEMBLJ9QGM73e-88J9QGM7_ERATE; Uncharacterized protein
STRINGSi015156m2e-74(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25013893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.14e-08lateral organ boundaries-domain 29