PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462862785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bHLH
Protein Properties Length: 93aa    MW: 10270.7 Da    PI: 9.4376
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462862785genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH20.87.1e-0721601554
               HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
        HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
               +i +  ++L+ llP+a   +s ++  a +L++++ YI+sL
  462862785 21 QISDLVAKLQALLPEARLRSSDRMPSARVLQETCSYIRSL 60
               789999*********8899999****************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.801660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.5E-72075IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.3E-82082IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRPRSRA SGGASRISDE QISDLVAKLQ ALLPEARLRS SDRMPSARVL QETCSYIRSL  60
HREVDDLSDR LSELLATSDV STAQAAIIRS LLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462862785
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0938691e-82FP093869.1 Phyllostachys edulis cDNA clone: bphyst028g12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983143.16e-44transcription factor ILI7
RefseqXP_025797606.16e-44transcription factor ILI7
SwissprotA2Z7302e-41ILI7_ORYSI; Transcription factor ILI7
SwissprotQ338G62e-41ILI7_ORYSJ; Transcription factor ILI7
TrEMBLA0A2S3IMI61e-42A0A2S3IMI6_9POAL; Uncharacterized protein
TrEMBLA0A2T7C6W61e-42A0A2T7C6W6_9POAL; Uncharacterized protein
TrEMBLA0A3L6SFA91e-42A0A3L6SFA9_PANMI; Transcription factor ILI7
TrEMBLK4AH621e-42K4AH62_SETIT; Uncharacterized protein
STRINGPavir.Ia01776.1.p1e-46(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-33bHLH family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]