PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-20666257
               T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  462862148  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
               58*****************99**************************************97 PP

2Wus_type_Homeobox119.91.1e-38567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
          462862148  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
SuperFamilySSF466892.61E-11470IPR009057Homeodomain-like
CDDcd000865.65E-4560No hitNo description
PfamPF000464.0E-18766IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-7866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHHHHH QPPPIPPPPA AGSSAAAVTV HPASYAAASF IQHPHLGGYM  120
GMGTLPVVQH PAAARGGGDK MATAPTGGAA FYSSGNNNNN NCSQQDWTTM SMEPNCTASP  180
GSSDDGFPLP PCCRRPLKTL DLFPTKSSTG GLRDECSSSK SSSFHEYGGY LGSLPVVQHP  240
AAAAAAGGGG NKMATAPAGG PALYSSGNNN NSSQGDWTTM SMEPNCTASP GSSDDGFPLP  300
PCCRRPLKTL DLFPTKSSTG GLRDECSSSK SSSGQRSSLG SSVCFSFPFA KFVGTPLSEN  360
DFIRFSRGRV AKSPIDYLLG ILISRLRGVE QVGSSTCRRP EIIGELIRNI IGVSPAIFSI  420
KYLSSSAAKT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9690874e-89EU969087.1 Zea mays clone 325979 WUSCHEL-related homeobox 3B mRNA, complete cds.
GenBankBT0661204e-89BT066120.1 Zea mays full-length cDNA clone ZM_BFb0350F05 mRNA, complete cds.
GenBankAJ5365784e-89AJ536578.1 Zea mays mRNA for homeodomain transcription factor (prs gene).
GenBankJX4699424e-89JX469942.1 Zea mays subsp. mays clone UT3202 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105160.14e-57WUSCHEL-related homeobox 3A
SwissprotQ70UV15e-59WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLB6TVS21e-57B6TVS2_MAIZE; WUSCHEL-related homeobox 3B
STRINGGRMZM2G069028_P011e-56(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-31WOX family protein