PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462861340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 220aa    MW: 25057.4 Da    PI: 8.2031
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462861340genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.67.9e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  462861340  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
               79***********************************************96 PP

2K-box58.23.7e-2071164198
      K-box   1 yqkssgksleeakae.slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                yq++ g+sl+++++e ++q+ l+ Lk+ ++nL++e+R+++GedL+sL++ eL+ Leq+++ +lk      ++++++q+e+ +kk k   e+ k+L+++l
  462861340  71 YQQAIGTSLWTEQYEvNMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFDELRGLEQNVDVALK-----EYHVITTQTETYKKKVKHSYEAYKNLQQEL 164
                67777888888877659*********************************************96.....59************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.59161IPR002100Transcription factor, MADS-box
CDDcd002657.29E-44280No hitNo description
SuperFamilySSF554552.62E-35287IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.87185170IPR002487Transcription factor, K-box
PfamPF014861.7E-1386164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
GTDIKTIFDR YQQAIGTSLW TEQYEVNMQR TLSHLKDINR NLRTEIRQRM GEDLDSLEFD  120
ELRGLEQNVD VALKEYHVIT TQTETYKKKV KHSYEAYKNL QQELGMREDP AFGFVDNTGA  180
AGWDGAVALG GAPDMYAFRV VPSQPNLHGV AYGSHDLRLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-17173171MEF2C
5f28_B2e-17173171MEF2C
5f28_C2e-17173171MEF2C
5f28_D2e-17173171MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462861340
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027210.0KJ002721.1 Phyllostachys edulis MADS-box protein 16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812646.11e-154MADS-box transcription factor 16
SwissprotQ944S91e-134MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLA0A2S3HGN11e-153A0A2S3HGN1_9POAL; Uncharacterized protein
TrEMBLA0A2T7DU701e-153A0A2T7DU70_9POAL; Uncharacterized protein
STRINGSi007221m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-59MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Chen ZX, et al.
    Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice.
    Planta, 2006. 223(5): p. 882-90
    [PMID:16254725]
  3. Zhang Q, et al.
    Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull.
    J Genet Genomics, 2007. 34(6): p. 519-26
    [PMID:17601611]
  4. Yoshida H, et al.
    superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
    Plant Biotechnol. J., 2007. 5(6): p. 835-46
    [PMID:17764519]
  5. Yao SG,Ohmori S,Kimizu M,Yoshida H
    Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
    Plant Cell Physiol., 2008. 49(5): p. 853-7
    [PMID:18378529]
  6. Xiao H, et al.
    STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice.
    Plant J., 2009. 59(5): p. 789-801
    [PMID:19453444]
  7. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  8. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  9. Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
    Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58.
    Plant Sci., 2012. 183: p. 183-9
    [PMID:22195592]
  10. Ohmori S,Tabuchi H,Yatou O,Yoshida H
    Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation.
    Breed. Sci., 2012. 62(2): p. 124-32
    [PMID:23136523]
  11. Yun D, et al.
    OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice.
    Mol Plant, 2013. 6(3): p. 743-56
    [PMID:23300256]
  12. Lombardo F, et al.
    The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice.
    Plant Biotechnol. J., 2017. 15(1): p. 97-106
    [PMID:27336225]