PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462858742
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family WOX
Protein Properties Length: 258aa    MW: 29142.3 Da    PI: 6.374
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462858742genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.41.9e-2188148257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+++t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  462858742  88 RQRWQPTPMQLQILENIFDQgNGTPSKQKIKEITAELshhgQISETNVYNWFQNRRARSKR 148
                89*****************99**************************************97 PP

2Wus_type_Homeobox101.46.5e-3387150265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RW Ptp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
          462858742  87 ARQRWQPTPMQLQILENIFDQGNGTPSKQKIKEITAELSHHGQISETNVYNWFQNRRARSKRKQ 150
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1783153IPR009057Homeodomain-like
PROSITE profilePS5007114.984149IPR001356Homeobox domain
SMARTSM003892.1E-1486153IPR001356Homeobox domain
SuperFamilySSF466891.58E-1887151IPR009057Homeodomain-like
CDDcd000869.45E-1588150No hitNo description
PfamPF000463.1E-1988148IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEWGNGAKAS AADERGGGGE PLGYVQVMTD EQMEVLRKQI SIYATICEQL VEMHRALTEH  60
QDSIAGMRFS NLYCDPLIVP GGHKITARQR WQPTPMQLQI LENIFDQGNG TPSKQKIKEI  120
TAELSHHGQI SETNVYNWFQ NRRARSKRKQ AASLPNNAES EAEVDEESLT DKKPKSDRIL  180
QQTNVHNADR ISEMHHLEHN QMGGMMYGSN DNNFRPSGSS GQMSFYENIM SNPRIDHFPG  240
KVESSRGYSH LQHGEGFD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288365.11e-161WUSCHEL-related homeobox 8-like
RefseqXP_008652675.11e-161PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-125WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A096QE431e-161A0A096QE43_MAIZE; Uncharacterized protein
STRINGGRMZM2G069274_P011e-161(Zea mays)
STRINGGRMZM2G038252_P021e-161(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.18e-59WUSCHEL related homeobox 13